SecReT6
Protein ID: 403521438
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0145
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]138456..140336 [-]
Producthypothetical protein
NoteTssF
UniProt IDK7QAK5
KEGG IDbpq:BPC006_II0145
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|403521438|ref|YP_006657007.1| hypothetical protein BPC006_II0145 [Burkholderia pseudomallei BPC006]
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSARTQLKLEAEFPR
FTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWP
IEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFEL
IHASSVASVVRAPGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQ
LNAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c140336-138456 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGGACCCGCAGTTTCTCGATCACTACAACCGCGAATTGACCTACATGCGGGAGTTGTCCGCGGAATTCG
CGGCGCAACACCCGAAGATCGCGCGCCGACTCGGCATGCAAGGCATCGAAGTGGCGGACCCGTACGTAGA
ACGGCTCATCGAGGCGTTCTGCTTCATGTCCGCGCGCACGCAACTCAAGCTCGAGGCCGAGTTCCCCCGC
TTCACGCAACGCCTGCTCGAAGTCGCCTATCCGAATTACGTCGCGCCGACGCCGTCGATGGCCGTCGCGC
GCCTGCGTCCAAGCCTGCGGGAAGGCGACTTCAGCAAGGGGTTCAAGGTTCCGCGTCACAGCATGCTGCG
CTCGTCGATCCCGCCCGGCGAGCAGACCGCATGCGAATTCCGCACCGGCCAGGACATCACGCTCTGGCCC
ATCGAGATCGCCGGCGCGACGCTGACCGCCGTGCCGCCCGATCTTCCGGATCTTCAGCGCAGCCTGCTGC
CGCACACGAAGCTGCGCGGCGCACTCCGGCTGCGCGTGCGCACCGTCGGCGAAATCAGGTTTTCGCAAAT
TACCGGGCTCGATCGCCTCTCGCTGTATATCGGCGGCGACGAACGCATCGCCTCCCATCTTTTCGAGCTG
ATTCACGCGAGCAGCGTCGCGTCGGTCGTGCGCGCGCCGGGCGCCGCGCGCGGCGAAGGCGCCGTCGTCG
CGAAGAATGCGGTCGACTTCGAAGGCCTGTCGCCCGATCAAAGCCTGTTGCCGCTCGTCTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAATACTTCACCTGCCGTCAGCGCTTCTATTTCTTCGCGCTCACGCAA
TTGAACGCCGGCTTGTCGCGCATCGACGGAAAGGAAGCCGAAATCGTGCTGTTGCTCGACCGCTTGCCCG
ACGAGCTCGTCACGCACGTCGAGGCCGCGCGCTTTCTGCTGTTTTGCGCCCCCATCGTCAATCTGTTCCC
GAAGCGGACCGACCGGGTGGAAATCAATCGCGCCCAAACGGCTTTCCACCTGATACCGGACCGCACCCGC
CCGCTCGATTACGAAGTATTCTCGGTGTCGCGCGTGTTCGGGCAAAAAGCCGAGACGTCGACGGAAGTCA
CGTTCAATCCGCTCTATCAGACGCTGCATAGCGACATCGGCAATTACGGCCGGTATTTCTCGATCCTGCG
CGAACCCAGAACGACATCGACCAACGCACGCAAGTATGGAACGCGCACGCCATACGTCGGAACGGAAGTC
TACGTGTCGCTCGTCGACCAGGCCGAAGCGCCGTACGCCGACGACATTCGTTACCTGTCCGTCGACGCAT
GGGTCACCAACCGCGATCTGCCCCGACTGATCCCGCGCAACGGCGTCAACGATCTGACGATGCAAGACTC
CGTGCCGATCGAGGGCGTGAGCCTCGTCCATCCGCCGAGCGCGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCGTGGCGGCTGATTCGCCAGCTCAGCTTCAACTACATGCCGCTTGCCGAGCTCGACCACCGCGACG
GCGGGCAAGCACTGCGCAACATGCTGCGCCTCTTCGTCGGCACGAGCGAGCGCGAACAGGCCACGCAGAT
CGACAGCCTGGTCGGCGCGCGCACGGAGCCTGTCGTCCGCCGTCTGCCCGGCCACGGATTACTGGTTTAC
GGGCGCGGCGTCCGGTGCGAGCTGACCGTCGACGAAAGCGGCTTCTCCGGGTTGAGTCCATACCTGTTCG
GTCTCGTGCTCGAGCAATACCTCACGCGCCACGTCTCGATCAATGTGTTCACCGAGACGGAGCTTCGCTC
GATGCAACGCGGCCTCGTCACGCGCTGGAAACCGCGCATGGGCGGAAGGGGCGCGGTATGA
 Primer design