SecReT6
Protein ID: 403521439
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0146
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]140338..140856 [-]
Producthypothetical protein
NoteTssE
UniProt IDK7PXN0
KEGG IDbpq:BPC006_II0146
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|403521439|ref|YP_006657008.1| hypothetical protein BPC006_II0146 [Burkholderia pseudomallei BPC006]
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDARRYPL
VSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c140856-140338 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCGGCATCCTGAAGGACGGCATCGGGCCGCCTATCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCACGCGCTCAGCGAATCGCCCGATGCCTATGCGCCGAGCGCCGACGAAATGCGCCGCATCGTGCA
GCGAGACCTGAGCCTGTTGCTGAACACCAGCAATCTGGACGACGAGGTGGACGCCCGCCGCTATCCGCTC
GTGTCGGCATCTGTCGTCAACTATGGCGTGCCGCCTTTGGCGGGCAGCTATCTGCACGACCGGAACCGGG
AAACGATCGAGCGCCTCGTGCGCACCGCGATCGCCCACTTCGAGCCGCGCCTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACCGGGCGCCAGCTACAACAAATTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAATTGAATCGAGTCACGC
TCGAGAAGACGACGCTCAACGGAAATTGA
 Primer design