SecReT6
Protein ID: 403521440
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0147
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]140843..141649 [-]
ProductImpE/SciE family protein
NoteTagJ
UniProt IDK7Q673
KEGG IDbpq:BPC006_II0147
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.70E-44, Aligned region: 139..259
Protein Sequence: 268 a.a.     [Download]
>gi|403521440|ref|YP_006657009.1| ImpE/SciE family protein [Burkholderia pseudomallei BPC006]
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEPQGEARAQLHR
GLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGS
FAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSG
SENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
 
Nucleotide Sequence: 807 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c141649-140843 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGCTGCGCGACGCGCTGCGCGCCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAA
AGCGGCCATCCGACACGCGGGAACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCG
CGCGCTCAAACAGCTGCAAACCTGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGC
GGCCTGATCCGATGCGAAATGTTCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACG
CGCAGCCCGCCTGGGTCGACACGCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGC
GGACACGCTGCGCGAAGCCGCGTTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGC
TTCGCATGGCTTACCGACAGCGACACCCGCCTCGGTCCGATCTTTGAAATAGCGGTTGCAGGCGGCTATC
GATGGATTCCGTTCGAACAACTGAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTG
GCGACCGGTCACGGCACTCATGCTCGATGCCACGGTTCTCCGCGGCTATGCACCCACCCGCTATTCGGGA
TCGGAGAACGGCGCGACCGCGATCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAACG
TCGTGGCGCTCGGACAACGAACATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATG
CCGCTTCACGGGCGAAAGCGACGATGCGGCATCCTGA
 Primer design