SecReT6
Protein ID: 403521443
SecReT6 ID694
T6SS typei3
Gene symbol-
Locus tagBPC006_II0150
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]143082..145811 [+]
Productchaperone clpB
NoteTssH
UniProt IDK7QAK8
KEGG IDbpq:BPC006_II0150
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.30E-39, Aligned region: 258..338
AAA_2 [PF07724], Evalue: 9.30E-39, Aligned region: 636..801
AAA [PF00004], Evalue: 9.00E-21, Aligned region: 260..391
AAA [PF00004], Evalue: 9.00E-21, Aligned region: 641..725
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 468..485
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 808..881
AAA_5 [PF07728], Evalue: 5.20E-15, Aligned region: 260..338
AAA_5 [PF07728], Evalue: 5.20E-15, Aligned region: 640..759
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 237..281
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 301..338
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 405..426
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 611..683
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 705..724
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 803..840
Sigma54_activat [PF00158], Evalue: 3.50E-09, Aligned region: 256..340
Sigma54_activat [PF00158], Evalue: 3.50E-09, Aligned region: 640..739
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 260..341
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 639..663
AAA_22 [PF13401], Evalue: 6.70E-08, Aligned region: 702..727
AAA_19 [PF13245], Evalue: 1.80E-07, Aligned region: 258..286
AAA_19 [PF13245], Evalue: 1.80E-07, Aligned region: 638..662
AAA_17 [PF13207], Evalue: 9.00E-06, Aligned region: 260..299
AAA_17 [PF13207], Evalue: 9.00E-06, Aligned region: 640..678
AAA_18 [PF13238], Evalue: 1.60E-05, Aligned region: 260..321
AAA_18 [PF13238], Evalue: 1.60E-05, Aligned region: 641..672
Zeta_toxin [PF06414], Evalue: 2.70E-05, Aligned region: 260..282
Zeta_toxin [PF06414], Evalue: 2.70E-05, Aligned region: 633..680
AAA_29 [PF13555], Evalue: 3.40E-05, Aligned region: 252..279
AAA_29 [PF13555], Evalue: 3.40E-05, Aligned region: 638..665
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 260..288
NACHT [PF05729], Evalue: 6.20E-05, Aligned region: 640..667
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 260..284
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 464..513
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 638..666
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 251..280
IstB_IS21 [PF01695], Evalue: 0.00015, Aligned region: 640..660
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 260..340
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 639..727
DEAD [PF00270], Evalue: 0.0029, Aligned region: 248..273
DEAD [PF00270], Evalue: 0.0029, Aligned region: 332..344
DEAD [PF00270], Evalue: 0.0029, Aligned region: 404..429
DEAD [PF00270], Evalue: 0.0029, Aligned region: 640..822
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 260..286
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 320..340
TIP49 [PF06068], Evalue: 0.0032, Aligned region: 639..675
RNA_helicase [PF00910], Evalue: 0.004, Aligned region: 261..281
RNA_helicase [PF00910], Evalue: 0.004, Aligned region: 641..662
T2SE [PF00437], Evalue: 0.0066, Aligned region: 250..280
T2SE [PF00437], Evalue: 0.0066, Aligned region: 636..709
NTPase_1 [PF03266], Evalue: 0.0095, Aligned region: 260..282
NTPase_1 [PF03266], Evalue: 0.0095, Aligned region: 640..662
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 260..272
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 638..658
Protein Sequence: 909 a.a.     [Download]
>gi|403521443|ref|YP_006657012.1| chaperone clpB [Burkholderia pseudomallei BPC006]
MHETKPDRGRDFPVLCANVAYSRIHDRDMTVSRQALFGKLGYSLFRSIESATAFCKLRGNPYVELVHWLH
QMLQAADGDMQRIARHCDIDLGELERDMVRALGELPAGASSISDFSHHIETAIERAWVLATLDFGDRRIR
GAWLLAALLKTPELRRVLLSISSAFGRIRVDELDAMLPAWIDGSPEANETPYDNSDFGAAIPGEASSAMQ
QKGGGSPLEQFCLDLTARARAGQIDPVVGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAI
AAGDVPPKLADARLLSLDVGALLAGASMKGEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTG
DAANLLKPALARGTLRTIGATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRTFSRHHGV
VVLDEAIRAAVKLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDVRRRLEAARVRLELLDGEQ
RIGLGDEAALAQSRAEIAALEVEEQSIDACWRQQIEAAQTLLSAREAAGDAAASAIDALRELEHALSNLQ
GDHAFVFPEVNEAIVAEIMSDWTGIPVGRMVTDEVSAVRALPDTLAARVIGQRDALHQIGDRVQTARAGL
TDPKKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGV
LTEAVRRRPYSVVLLDEIEKAHPDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGLCMD
EACAPDADGLCAALASELLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVTRMAENQAVALRYSD
NVVDYVVNRCLVQETGARLLIGFIEQHVLPLLAKLWLDSLASKHVLTRVDLDMADPAAAPAEAFALRAS
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|403521294|ref|NC_018529.1|:143082-145811 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
TTGCACGAGACGAAACCGGATAGGGGACGCGATTTTCCGGTTTTGTGTGCAAACGTCGCATATTCACGAA
TTCACGATCGAGACATGACAGTTTCAAGACAGGCACTATTCGGCAAGCTCGGCTACTCGCTGTTTCGCAG
CATCGAATCGGCGACGGCGTTCTGCAAGCTTCGCGGCAACCCTTACGTCGAGCTGGTGCATTGGCTGCAT
CAGATGCTTCAGGCCGCTGACGGCGATATGCAGCGGATCGCTCGCCACTGCGACATCGACCTCGGCGAGC
TGGAGCGCGACATGGTGCGCGCGCTCGGCGAACTGCCGGCGGGCGCGAGCTCGATCAGCGATTTCTCGCA
CCACATCGAGACGGCGATCGAGCGCGCGTGGGTGCTGGCGACACTGGACTTCGGCGATCGCCGGATTCGC
GGCGCGTGGCTACTGGCTGCGTTGCTGAAGACGCCGGAGCTCAGGCGCGTACTGCTGTCGATTTCGTCCG
CGTTCGGCCGGATTCGTGTCGACGAACTGGATGCGATGTTGCCGGCCTGGATCGACGGCTCGCCCGAGGC
GAACGAGACGCCGTACGACAACAGCGACTTCGGCGCGGCCATACCGGGCGAGGCGTCGAGCGCGATGCAG
CAAAAGGGCGGCGGTTCACCGCTGGAGCAGTTCTGCCTCGACCTCACCGCGCGAGCGCGAGCGGGGCAGA
TCGATCCGGTCGTCGGTCGTGAGCTGGAAATCCGCACGATGATCGACGTCCTGTTGCGCCGCCGCCAGAA
CAACCCGCTGCTGACGGGCGAGGCGGGTGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCGCGCGATC
GCCGCCGGCGATGTGCCGCCGAAGCTTGCCGATGCGCGCCTGCTGAGCCTCGATGTCGGCGCGCTGTTGG
CCGGGGCGAGCATGAAGGGCGAATTCGAGGCGCGCCTGAAAGGCGTGCTGGAGGCGGCGGCGAAAGCGAC
GCTGCCCGTCATTCTGTTTGTCGACGAGATTCACACGCTGATCGGCGCGGGCGGCCAGGCGGGCACCGGA
GATGCCGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGGCACGCTGCGAACGATCGGTGCGACGACGTGGG
CGGAATACAAGCGGCACATCGAAAAGGATCCGGCGCTCACACGCCGCTTCCAGGTGTTGCAGGTTCCCGA
GCCCGACGAGGCGGCCGCGATCGACATGGTTCGAGGGCTGACGCGAACCTTCTCGCGTCATCATGGCGTC
GTCGTGCTGGACGAGGCGATTCGCGCGGCGGTCAAGCTGTCGCATCGCTACATTCCATCCCGTCAGTTGC
CGGACAAGGCGATCAGCCTGCTCGATACGGCGTGCGCGCGCGTCGCGTTGTCGCAGCATGCGCCGCCGCG
TGAGCTGCAGGACGTCCGCAGAAGATTGGAGGCCGCGAGGGTGCGGCTCGAATTGCTCGACGGCGAGCAG
CGCATCGGCCTTGGCGACGAAGCCGCGCTCGCGCAGTCTCGCGCGGAAATCGCCGCGCTCGAGGTGGAGG
AGCAATCGATCGACGCTTGCTGGCGGCAGCAGATCGAGGCCGCGCAGACGCTGCTCAGCGCGCGCGAGGC
GGCGGGCGACGCTGCGGCGAGCGCGATCGACGCGCTGCGCGAGCTGGAGCATGCGCTGTCGAACCTGCAA
GGCGATCACGCGTTCGTTTTCCCCGAGGTCAACGAAGCGATCGTCGCGGAGATCATGTCCGACTGGACCG
GCATTCCGGTCGGCAGGATGGTGACGGACGAAGTGTCCGCCGTGCGCGCCTTGCCGGACACGCTCGCCGC
CCGCGTGATCGGTCAACGCGATGCGTTGCATCAGATTGGCGATCGGGTGCAAACGGCGCGCGCCGGATTG
ACCGATCCGAAGAAGCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCGTCGGCAAGACGGAGACGG
CATTGGCGCTTGCCGAGGCGCTGTACGGCGGCGAGCAGAATCTCATCACGATCAACATGAGCGAATATCA
GGAGGCGCATACGGTATCGGGGCTGAAGGGCGCCCCGCCGGGTTACGTCGGATACGGCGAGGGCGGCGTG
CTGACCGAGGCGGTGCGCAGGCGTCCGTATTCCGTCGTGCTCCTCGACGAGATCGAGAAGGCGCATCCCG
ACGTCCACGAGATGTTCTTCCAGGTATTCGACAAGGGCTACATGGAGGACGGCGACGGGCGCTATATCGA
TTTTCGCAACACGACGATTCTTCTCACCAGCAATGCAGGCTCCGACCTCGTGTCCGGACTGTGCATGGAC
GAGGCTTGCGCCCCCGACGCGGACGGCCTTTGCGCCGCGCTCGCTTCCGAATTGCTCAAGACGTTTCCCG
CGGCGTTTCTCGGGCGCGTGACGCTGGTGCCCTATCGTCCGCTCGCGCAGGAAACGCTATCGCGCATCGT
CCGGCTGCATCTGGACCGAGTGGTGACGCGAATGGCCGAGAATCAGGCTGTCGCCCTGCGTTATTCGGAC
AATGTCGTCGATTACGTCGTCAACCGCTGCCTCGTGCAGGAAACGGGGGCGCGCTTGCTGATCGGCTTCA
TCGAGCAGCACGTGTTGCCGCTGCTCGCGAAGCTTTGGCTGGATTCGCTTGCGTCCAAGCACGTGCTGAC
ACGCGTCGACCTCGACATGGCCGATCCCGCCGCGGCCCCGGCCGAAGCGTTCGCGCTGCGCGCTTCATGA
 Primer design