SecReT6
Protein ID: 403521518
SecReT6 ID695
T6SS typei3
Gene symbol-
Locus tagBPC006_II0225
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]220065..224141 [-]
ProductImcF/SciS family protein
NoteTssM
UniProt IDK7QAP8
KEGG IDbpq:BPC006_II0225
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-96, Aligned region: 632..952
ImcF-related_N [PF14331], Evalue: 3.30E-93, Aligned region: 313..585
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 951..979
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 1060..1184
Protein Sequence: 1358 a.a.     [Download]
>gi|403521518|ref|YP_006657087.1| ImcF/SciS family protein [Burkholderia pseudomallei BPC006]
MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLLWLAGRPTSIV
FVALLCVLIWHASPLLAFGGATPFAPEAVRAIAIALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQ
PESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSF
PVAAQMPRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPADAAADARRA
NGQPAGERHAVAMAAAAPSSAAFVDERLAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTS
ADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQAWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDRVFADSRYDDT
QHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDAR
LVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEA
VPDVLTQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIAD
RDPKAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIR
NDALIRQARAFLDGSNATERLYERAKAAMDKEAPDEFTLLRAIGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAF
LGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALG
VRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSM
PPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDS
KRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFG
APGQKQMAWKADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAAITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMF
SLADTGAPPGLPPGSPAAPTSRVARDGR
 
Nucleotide Sequence: 4077 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c224141-220065 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAACAAGTTCCTGTCCTTTCTGGTGTCTCGATCGTTCATCGCGTTCGTCGCGCTGCTCGCCGTCGCGC
TCGTCATCTGGTTCGTCGGCCCGTTCGTCGCGTTCGGCGGGCTCACGCCGCTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCCGGCCGACGAGCATCGTG
TTCGTCGCGCTGCTGTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCGGCGCGACGCCGT
TCGCGCCGGAGGCGGTCCGGGCGATCGCGATCGCGCTCGTGCTCGCGGCGTTCGCGCTGCACCTTGCGTT
CCGGCTGCTGCAAAAGGCGCGCACCGATCCGGATTTTCTGAAGAGCTTGCTCGAATTCGGCGGCAAGCAG
CCCGAATCGCCCGCGGCCGGCCGCCTGGTGGCGGTCAACGCCGCGATCGCCGGCGCGATCGCGCGCCTGA
AAGGCATGCGCAGCGGCGCGCGCGGCCTGCGCCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCGGGCATGCGGCAAGACGAGTGCGCTCCTGAACGCCGGGCTCTCGTTT
CCGGTCGCGGCGCAAATGCCGCGCGCGGCAGCCGGGCTGCCGGATCACGGCGGCTCGGTCGACTGGTGGT
TGACCAACGATGCGGTGCTGATCGACACGGCCGGCCATTACACGCGTCACGGCACGTCGGCGCACGCGGC
GCCGCTGCCGCCCGCCGGGCCCGCGCCGCACGCCCAGCCCGCCGACGCGGCCGCCGACGCGCGCCGCGCG
AACGGTCAGCCGGCGGGCGAGCGGCACGCCGTCGCGATGGCCGCGGCGGCGCCGTCGAGCGCCGCGTTCG
TCGACGAGCGGCTGGCGCAATGGCGGCAGACCGTCGACCAGGCCGAATGGCTGGGCTTTCTGCGGACGCT
GCGCAAGCATCGGCCGCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCACGCTCACGAGC
GCCGACGACAATGCGCGCCATGCCGAGGCAGCCGCGCTGCGCGCGCGGCTCGCCGATCTGCGCGCGCAAC
TGGGCGTGCGCTTTCCCGTCTATCTGATCGTCACGAAGACGGACCAGTTGCCGGGCTTCGCCGAATACTT
CAGCGCGCTGACCACGGAGGGCCGCGCGCAGGCGTGGGGGTTCACGCTGCCGTACGACAAGGAGACCATC
GCGGACGAAGGCGTCCACGCGCGCTGCGCCGACGAGCTGCGCGCGTTGGCCGCGCGGCTCGCCGCGGGCG
TGAACACCCGCCTGCAGGAAGAGCACGACACGCAGCGGCGCCGCCGGCTCGCCGCGCTGCCGGAGGAATT
TCTCGTGCTGACACGCCCGCTCGGCGAGCTGATCGATCGCGTCTTCGCCGATTCCCGCTACGACGACACG
CAGCATCACGCGACGCTGCGCGGCGTGTATTTCACGAGCGCCGCGCAGACGGGCGGCGAGGCCGCCGCCG
AAACGCGCACCGTAGCGCGACGCCTCGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCGCGCGCGCGGC
GCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCCGGACGCACGC
CTCGTCCAGCCGAACCTTCGCTGGGAGTATCGCTCGCGCACGCTGAGCCTCGCCGCTCACGCGCTCGCGC
TGCTGCTGTTCGCGTGGGTCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGATGCCTATCTCGACGC
GCTCGCGCGCAAGACGGCGGCGCTCGCCTCCCGGGTCGACCAGTTGTACAAGGCGCCGAAGCCCGAGGCC
GTGCCCGACGTGCTGACGCAAGCCCGCTCGCTGAGCGCGTACCCGGGCCTCGATCTGTCCGCGCCGGGCA
GCGGCTGGCGGTTCGGCCTGTACACGCCGCCCGGCATCGTCGCCGAAAGCAGCCGCACGTACGACGCGCT
CGAGGACACCCTGCTGCTGCCGCGGATCGTCACGCGCATCGAGGCGGTGCTGTCGCAGGCGATCGCCGAT
CGCGATCCGAAGGCCGCGTACGACGCGCTGCGCGTCTATCTGATGCTGTACGACCGGGCCCGCTTCGATG
CCGCGCAGGTCGAGGCGTGGGTGCTCGACGACTGGGCGCGAACCGACAGCGCGGCGGTCTTCGGCGGCCG
CGCGTCGATGATCGCGCACGTCGAGCAACTGTTTCGCGGCGAGCGCATCGTGCAATCCCCGCTGATCCGC
AACGATGCGCTGATCCGCCAGGCGCGCGCGTTCCTGGACGGCAGCAACGCGACCGAGCGGCTCTACGAGC
GCGCGAAGGCGGCGATGGATAAAGAAGCGCCCGACGAGTTCACGCTGCTGCGGGCCATCGGCCCGCAGGC
CGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGGGGCGTGCCGGGCCTCTTCACGTTCGAC
GGATACCGGCGCGTGTTCGACAAGCGGCTCGCCGAATTCGTGCGGACCGCGCGCGAAGACGATGCATGGG
TGATGGGCCGCGCGTATCTCGGCGACGCTCAAAAAAAAACGGCTGAGATCGCGAATGCGCTCGCGGGGGC
CGACGATCCGCTGACCGACGCGATCCGCCGGCAATATCTGATCGAATACGCGCAGCAATGGGACGCGTTT
CTCGGCGACATCCGCACGATCGGCGGCACGAGCCTCGCATTCGATCTCGTGGTGCTGCGCAGCTTCGCGG
CGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGACGCTCGCGCAGCCCGAAGC
GAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCAGGCGGACAAGGCGCTCGGC
GTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCGGGCCTGCGCGAAATGGTGA
CGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCAAGAGCGGGCTCGATGCGGT
CGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGCGCTCGCGAACAACAGCATG
CCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATGCCCGCGCCGTTTCGCTCGG
TGCTGACCGGGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCGGCCAGTTGCTGTCGCGGCA
GTTGCAGGCGACGGTAGGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTATCCGTTCGCGCCCGACAGC
AAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGCGTGATCGACGACTTCTTCG
CGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACAAGACGCTGCCCGGCGCGAC
CGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGATTCGCGAAGTGTTTTTCGGC
GCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAACTGGACCCGACGATCACGA
GCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCGTCGCGCCGTTCGCGGTGAG
CTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGCGATCACCGCGAGCCCGCGCATCCGGCCGGACACGTCG
GCGGTGTCGACGGACGGCCCATGGGCGCTGCTGCGCCTGCTTCAGAAGGGACGCGTGAGCGGCACGGCGA
CGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGCTCGACCTCGCGAGCACGGG
CAGCGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCCGGGCTCGATGCCGATGTTC
AGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCGGCGCCGACGTCGCGCGTCG
CGCGCGACGGGCGGTGA
 Primer design