SecReT6
Protein ID: 403522045
SecReT6 ID696
T6SS typei3
Gene symbol-
Locus tagBPC006_II0760
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]761300..764803 [+]
Producthypothetical protein
NoteTssM
UniProt IDK7Q775
KEGG IDbpq:BPC006_II0760
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 493..799
IcmF-related [PF06761], Evalue: 2.80E-69, Aligned region: 867..880
ImcF-related_N [PF14331], Evalue: 2.90E-29, Aligned region: 188..377
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 80..99
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 300..318
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 904..1029
Protein Sequence: 1167 a.a.     [Download]
>gi|403522045|ref|YP_006657614.1| hypothetical protein BPC006_II0760 [Burkholderia pseudomallei BPC006]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPI
SGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWV
KGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKALVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVALERDAVR
PSGPKSWRGRLGEALRWGAVPLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTL
IEIANQMRYAQLQAEDAAQGMATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDI
YQTLKVYLMLCRPARRSADDVVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPEDANLVRS
ARAKAAQIPLVTRVLQHIHAQGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVF
LPRLQKSARAMLEEESWVLRDETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLD
DASQLAAAMMEAQSPLANLLRFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLL
PEHVVEEHFQAIRQLAAQLNRNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAAR
QPEPVRGIMLDLVSSGSTMTTRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDFERLFSAQ
GLMATYFRDHLAAYVDTSAKPWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVSTVLRFID
MDSQLSEAQLSVAGQTVRFAHGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQ
AVGGTGTADRRERLYQTSLGTVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|403521294|ref|NC_018529.1|:761300-764803 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCGCACTGGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCACCCTCGACCAGCAGTTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCGAGCATCGCAC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTG
AGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTGA
ACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGCGCGGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGCAAGCGGCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTCGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTCGAAGTGGGTC
AAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGACGCGAGCTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGGCGGCGACCGA
GGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGCGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTGTGGCTGGGCT
CGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGCTGCCCGTGCC
GTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCGCTCGAGCGCGACGCGGTGCGC
CCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTGCCCCTCGTCG
CGTTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGACTATCTGGACGGCGTCTGGGC
GCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGGCTCGACGCTC
ATCGAGATCGCGAATCAGATGCGCTATGCGCAACTGCAGGCCGAGGACGCCGCGCAGGGCATGGCGACGC
CGTACTTCGAGCACGGGCTCGTCGCGGAAACCGCGCGCGAGACCTACTACCGGCACTTGCAGAAGATGCT
GATGCCGGAGCTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCCGGGCGACATC
TACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCTCGGCGGACGACGTCGTGCGCT
GGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGACGACCGCCGCTCGCTGCTCGC
GCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAGGACGCGAATCTCGTGCGCTCG
GCGCGCGCGAAAGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCGCAGGGGCTGC
CGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCCTGCGCATGCG
CAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGCGCGGGCTACACGGACGTGTTC
CTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGCGACGAGACGC
TGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCAACCAGTTCCT
GCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGACGGGCCTGGAC
GATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTGCGCTTCGCCG
CGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAGCTGGATCGATCGCCAGAAGTA
CCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAGCATTACCGCACGGTGCTGCTG
CCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAACTGAACCGCAACAACA
CGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGGCAGCTCGGGCTCGTCAACGGCGC
GCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCACGGCTGAAGGAGACGGCCGCGCGC
CAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACGACGCGCGAAT
CGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCTTCACGGGCCG
CTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTCGAGCGGCTGTTCAGCGCGCAG
GGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCGTATGTGGACACGTCGGCCAAGCCGTGGCAGG
CGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCTGAACTCGTACGAGACGGCCGA
GCGCATCCGCGGCGCGATGCTCGACGATTCGGGACACCTGCGCGTGTCGACCGTGCTGCGTTTCATCGAC
ATGGATTCGCAGTTGTCCGAAGCGCAACTGAGCGTGGCCGGGCAGACGGTGCGCTTCGCGCACGGCGTGA
CCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGATCAAGCTGCAGCTCAAATCGGT
GGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGACGCGGGGCAG
GCGGTGGGCGGCACGGGCACTGCGGACCGGCGCGAGCGGCTGTATCAGACGAGCCTCGGCACGGTGCGCA
TCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCAGGTGTCCGTC
GTGA
 Primer design