SecReT6
Protein ID: 403523303
SecReT6 ID697
T6SS typei1
Gene symbol-
Locus tagBPC006_II2023
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2067112..2071131 [+]
Producthypothetical protein
NoteTssM
UniProt IDK7QC08
KEGG IDbpq:BPC006_II2023
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-48, Aligned region: 176..421
ImcF-related_N [PF14331], Evalue: 3.50E-48, Aligned region: 1098..1138
Protein Sequence: 1339 a.a.     [Download]
>gi|403523303|ref|YP_006658872.1| hypothetical protein BPC006_II2023 [Burkholderia pseudomallei BPC006]
MKTLGMMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDA
SERLPAADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRH
ARDDAAIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPR
LIEASRDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDA
DAFVARALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLL
FASGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAW
LLASIAAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLERIGRVIADVERRDERRLVRPLAG
ATPVGRLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDVRAADDARLAARIRNLVRYVNLMQARRRGA
DRETLAQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGGVGGVGGVGGVGGVGGVGGARAAEGA
GRAVRASGGRRAGDARAARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALA
ARVAAAQAELERLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAH
RPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADR
RDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALR
EALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAAD
SALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYG
PQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALE
LDERIASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQP
DRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGH
DALLAHVGRIDALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHD
RPDGDGAQP
 
Nucleotide Sequence: 4020 bp     [Download]
>gi|403521294|ref|NC_018529.1|:2067112-2071131 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAAGACTCTCGGCATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGA
GCGCGCTCTATTTCGACTGGCCGCTGTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCT
GCTGTGCCGCGTCGCGCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCA
TCCGAGCGCCTGCCCGCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCG
CGCTCGGGCGCGCGCAGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGT
GATCGGCCCCGAGGGCGCGGGCAAGACAACCGCGCTCGCACGCGCGCGCCTCGTGTCGCCGCTGCGGCAC
GCGCGCGACGACGCGGCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGC
TCGATCTCGCGGGCCGCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCT
CGAGCAGCTCGGCCGCGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGC
CTCATCGAAGCGAGCCGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGA
TCCGCCTGTTCGACCGGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGA
CGAATGGGCCGCGCAGCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCG
GATGCGTTCGTCGCGCGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCACTGCGCGTCGCGCTGGCGG
CGCGCGGCGAGCCGCCGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCT
CGAGGCGTTCGCACGCGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTG
TTCGCGAGCGGCCGGCAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGG
CGCGCACGCCCGGCGATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGA
CGCGTGGCTGCCCGTCGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGG
CTCCTCGCGAGCATCGCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGC
TGGTCCGCCGCGACTATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGA
GCGGATCGGCCGCGTGATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGC
GCGACGCCCGTCGGCCGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCG
AACCCACCGCCGATCGGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACGTGCGCGCGGCCGACGATGC
GCGGCTCGCCGCGCGCATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCG
GATCGCGAGACGCTCGCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCG
GAGTGGACAGTGTGGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGG
CGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGCGCG
GGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGCATGCGCGGCG
CCGCCGGCAACGCCGGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGG
GTTCGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCC
GCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGC
TCGCGCTGCCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCGCCGAGCCGCG
CACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCAT
CGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCC
ATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTT
CCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGATCGCCGATCGC
CGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGACGACACGCTGC
CGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGCCCGCGCGCCT
GCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGC
GAAGCGCTCGGCGGCGCGCCCGAGCAAGGCAGGCTCACGCTCGAGCGCGATGCCGCGCTGCGCGACGCGC
TTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGATGCGCTTGCGGGCCCCGGCGCCGCGTACCG
GCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGAC
AGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCG
TCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAGGACGACTG
GGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCTGCTGTACGGC
CCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTG
CATCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGC
GGCCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAG
CTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGA
TCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCA
ATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCC
GATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGAT
CGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCC
GGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTTCTCCGGGCAT
GACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGC
AGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTC
CGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGAC
AGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design