SecReT6
Protein ID: 403524080
SecReT6 ID698
T6SS typei3
Gene symbol-
Locus tagBPC006_II2803
StrainBurkholderia pseudomallei BPC006
Repliconchromosome II [GenBank: NC_018529] [Browse all T6SS(s) in this replicon]
Location [Strand]2838747..2842376 [-]
ProductImcF-related protein
NoteTssM
UniProt IDK7QAV4
KEGG IDbpq:BPC006_II2803
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|403524080|ref|YP_006659649.1| ImcF-related protein [Burkholderia pseudomallei BPC006]
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFVAWGARIAWRG
WRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLA
SQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|403521294|ref|NC_018529.1|:c2842376-2838747 Burkholderia pseudomallei BPC006 chromosome II, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGACATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGTTTCGTTTGGCTTGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCGCCCGTTCGAGAG
CGGCGCGGTGCGCGCGGCGACGATCGTCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCGGC
TGGCGCGCGGGGCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCCGCGA
CGGGCGATCCCGCGCAGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCCGCGACGCTGTTGAA
GAAAGTCCGTTTCGGCGAAGCCGACGGCGCGCGCAAGGGCCTGCCGCGGTGGCTCGAGCAGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTACACGACGCAC
GAGAGCAACCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCGCGCAGCTCGGCATCCGCTTTCCG
GTGTATCTGCTCGTGACGAAGGCGGATTTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAAGCGCCCGGCTTCGAGCTGCG
CGCGGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTGCCGGAGCTGCTCGCA
TCGCAGACCGACGCGCGCCAGCGCGAGATGACCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
CTATCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGTCGGGCCGCAGTTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTTCGCGAGGCGGCGCTTGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGTGC
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGCGTGGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGACTATCTCGACGAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCGAAATTCACGGGCGCGGCCGACATCGTGCAGCTGCTGCCGGTGCTCGACGAGCTGAGCGGCCTGCC
GAACGCGGGCGGCGTGGACTTGCGGCATCCGCCGCTCGCGTATCGCTGGGGCCTGTTCCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTCTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGACGCGCGGCCCGACGAGGTCGAGTATGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTTTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCGGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCGCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTTCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTATCGGCAGCTCGCGCGCACGCTGCACGCGAGCACCGCGTCGTAC
GATTTCAGCGTCGCGCGCGCGGTGGGGCCGGACGCGTCGCTCGTGTTCCGGCGGCAGAGCGGCAAGAGCC
TCGCCGACGGCGTGCCGGGCCTCTACACGCGCAGCGGCTACCGCAACGTGTTCGCGCCGCGTCTGCCCGG
CGCGATCGATTCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTACCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAATCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAACTCGCTCGCGC
AGATCTTCGCCGGGCAGCCGGGCGGCGAAGCGGGCGCGGCGGCCGCGCCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGGGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCGACCGACGACGCATTGCGCAGCGGCG
CGGCGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGTTGCCGACGCCTGTGCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCATCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTACCCGTTCGCGCGCG
GCGCGGCGCGCGACGTCGCGCCGTCCGATTTCGCGCAGCTGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCATCCGTGGCGTTTCAACAACCGCAACGCC
GAAGCCGACCCGTCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCGGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
GGAGATGCTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGGGCGACGGGCG
GCTTCACGACCGAGGGCCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGTGGGCGCGG
ACCCGAGCAGATGGTCGCGAGATTCGCGGTCGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design