SecReT6
Protein ID: 407480464
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04430
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]900187..903600 [+]
Producthypothetical protein
NoteTssM
UniProt IDK0AJ43
KEGG IDesl:O3K_04430
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-13, Aligned region: 180..341
Protein Sequence: 1137 a.a.     [Download]
>gi|407480464|ref|YP_006777613.1| hypothetical protein O3K_04430 [Escherichia coli O104:H4 str. 2011C-3493]
MIFMLKKTFSLFLWFFVSVFVLSVCYVIGVFRNWTDTTTALYWISVILVTLSFKFIMDCIHNYFSAGKYR
NFLKSFSRKKRALTLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLLEDINLPVFHRNCVNSTPQQF
RTIRWWFFRDLSVLELSGKIYDNPGVINSVISSLSARKCKKQPPRGVVLVISADKLINHDYTYIRTLSQK
TRSFVEQLSLHLHHNIPVFIVISGCEHISGYSVLAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSS
LRSNIMASICHALDDSLSDKEKNDILQFPDRLKGLKYSLDIFISTFCIENVFFSQTEIAGICLSGELMGE
KDKNCIFADILISEILPQIHDSDVIHVNKQRVNVSFKSVIVMTALCFVGYSGYCSYNVYNIRHGSVDTSH
AFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNFMQASPSGKRE
LILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLAVERDEIQKNNGIENIYVFRN
LLTELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYLSGIWTQPGQNKLHQWYETIKEAYGRDTVPE
AFSSFVLYLDESRQEHFRQFIMSVARARKDSHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSA
QDWLSEFRLLNHLFSLKVDNGMKRQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSV
LHTASSVELIRNAMRSDPENKLVILFDEFEKVRSVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCW
VGEQWRKSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNGVLALDPDGVRLLSFRERSIPFSPSFIT
FINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRVTIDSAPATIPDNPRVKPTGT
TLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILFPNFSATYKFTGETAWIDFINKFSDGESELM
TKDFSPESRNFLESMGIKGILVRYKLSDTGNLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSA
WISRLPGNITICPVVQE
 
Nucleotide Sequence: 3414 bp     [Download]
>gi|407479587|ref|NC_018658.1|:900187-903600 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGATTTTTATGCTTAAGAAGACATTTTCATTATTTCTCTGGTTTTTTGTTTCTGTCTTCGTTCTGTCTG
TTTGCTATGTTATCGGCGTGTTCAGAAACTGGACAGATACTACAACTGCACTTTACTGGATTTCTGTGAT
TCTTGTTACTCTTTCCTTTAAATTTATTATGGATTGTATCCATAATTACTTTTCTGCAGGAAAATACAGA
AATTTTCTAAAGTCTTTCTCTCGTAAAAAGAGAGCATTGACGCTTGATTCGTATTTCAAAAAAGGTCTGA
ATATCATAAGTAAAAGGGGAAGAGGAGAGGTTCCTTGGTTCTTACTTACGGGAGATTCAGAAAAAAACAA
CTCTTTGCTTGAAGATATCAATCTTCCTGTCTTTCACCGTAATTGTGTAAATAGCACTCCCCAACAATTC
CGGACAATTCGTTGGTGGTTTTTCAGAGATTTAAGCGTGCTGGAGTTGTCAGGAAAGATATATGATAACC
CGGGAGTAATAAACTCTGTGATAAGTTCTTTATCAGCACGTAAATGTAAAAAACAGCCACCTCGTGGCGT
TGTTCTCGTCATTTCTGCTGATAAGCTAATTAATCATGATTACACCTATATTCGGACATTGTCTCAAAAA
ACAAGGAGTTTTGTAGAACAACTGTCGTTACACTTACATCACAACATTCCGGTCTTTATAGTGATTAGTG
GATGTGAGCACATCAGTGGATATTCAGTGCTGGCACAAAAAATCTATCAAAAACATGAAAAATGGCATCC
AGTGTTTTGGGCAACCAATAAATCAGGGACGAATGCATCTGAATATGATTCATCATACATATTATCATCA
TTAAGATCTAATATAATGGCATCAATATGCCATGCGCTTGATGATTCATTAAGTGACAAGGAAAAAAATG
ATATACTGCAGTTTCCTGATAGATTGAAAGGTCTAAAGTATTCACTTGACATATTTATTTCCACATTCTG
TATTGAGAACGTTTTTTTCTCTCAGACGGAAATTGCCGGGATCTGTTTATCTGGTGAACTCATGGGGGAG
AAGGACAAAAACTGTATTTTTGCTGATATCCTTATTTCCGAGATACTGCCACAAATACATGATTCAGACG
TTATTCATGTTAACAAACAAAGAGTGAATGTATCGTTTAAATCAGTTATAGTCATGACTGCATTGTGTTT
TGTTGGATATAGCGGATATTGTTCATATAATGTGTATAACATCAGACATGGTTCTGTTGATACCAGCCAT
GCATTTCTGACAGAGCAGATATCAAAATATGAAGACAAAGTTAGGTCTAACATGCGGTATTTCCCTTTTA
AGCCTGCACTAGATGATAAATATCTATTTTTCAGAGAATCTCTTCATAAAACAACAAGATTCGATATCAG
TCCTGTCTCATGGCGCGTTACTGAATATAAGAAGAATTTCATGCAAGCTTCACCATCAGGAAAGCGAGAA
CTAATTCTGTCGCTCTCATCATCACTTATCAGTTGGGATAAGATGATGAAAGATGAATCCCTGAGTGACT
TAGCAAAATCTCCTGGTATTCATGAGTTACTGAAGATAACCAGACCTCATGATAAAATATCATCAATAGC
TTCACTTGCTGTAGAAAGAGATGAGATACAGAAAAATAATGGAATTGAGAATATTTATGTGTTCAGAAAC
CTCCTGACTGAGTTGGTTCAGAGTGACCCGTCTTATTCATGGTTTGTTTCTGAAGATGTTAATATTCCTG
CTGTAAGAATTACGGACTTTTGGGAAGATGAAAACTCTTCTGTCTATCTTTCCGGAATATGGACACAACC
GGGACAGAATAAACTTCATCAGTGGTATGAGACTATCAAAGAGGCATATGGACGTGATACGGTTCCGGAG
GCGTTCTCATCCTTTGTGCTATACCTGGATGAAAGTCGTCAGGAGCATTTCAGACAGTTTATTATGTCTG
TTGCAAGGGCACGTAAAGACTCACATTCAGGTTTAATGAATCCGCTGCAACTGACCAATATTATACACAA
TCGCTCATCTGAGCATAGATTCTTTCAGTTTGTAGATGATGAATTACACAATATACCAACGAGTTCGGCG
CAGGACTGGCTTTCTGAATTCAGACTGCTTAACCATCTGTTTTCACTTAAAGTGGATAACGGAATGAAAC
GTCAAATAGAACAATTTGATCTCATGTTACGTATATACCTGATTTCTGTTCTTAATAACAGTCAAATGAA
CAGGACACTGACTCATGTTACCACATGGAGAAGCTGGCAGAATGCTCTACGTAATGCCGTGAATTCAGTG
TTACATACAGCATCATCAGTTGAACTTATTCGTAATGCCATGCGTTCAGATCCAGAAAACAAGCTGGTAA
TATTATTTGATGAGTTTGAAAAGGTTCGCTCAGTCATTAACAGCAATAATAGAGAGCCGGTGATTGATTC
TGTATGGGATATTTATGAGCGGCAGATTTATCAACTTCTCGACCATGCTGTCACTTATACAGGGTGTTGG
GTTGGTGAACAATGGAGGAAATCTGTTTTAGGCCGGTTTAACTCAGGAAAACATAATCTCAGTTATTCTG
AGATGCAGGGAAAAGTATATAAGGACATTATTGGCTTTTTGAAAGGTCCGTCTAACGGAGTTTTAGCGCT
TGATCCAGACGGTGTCAGACTGTTGTCCTTCAGGGAAAGAAGTATACCTTTTTCCCCTTCATTCATTACT
TTCATTAATGACATTGTTTCCCCGGATGATCTGCTTGATGTTTGGCTCAGAGAGCGAACGCAAAACAAGG
ATGAATTAATAAATGTACAGGGGCAACTAGACTTACTGAATCAGACCCTACAAAATGCTGAGTCACAGCC
TTACAGAGTTACGATAGATAGTGCACCTGCGACAATTCCGGATAATCCCCGAGTCAAACCAACAGGTACA
ACTCTGACTCTTGAGTGTAAAACAGGTAACAGCAGTATACGAAGTATGAATTTTGCTGATTCAGGTATTT
TTACCTGGTATCCGGGAAGCTGTCACTCTGTAAGAATTGACATTTTGTTCCCTAATTTTTCTGCCACCTA
TAAGTTTACAGGAGAAACAGCCTGGATTGATTTTATCAACAAGTTTTCGGATGGAGAGAGTGAGTTAATG
ACAAAGGATTTTTCTCCAGAATCAAGAAATTTTCTCGAATCAATGGGGATTAAAGGCATTCTTGTCCGTT
ACAAACTGAGTGATACAGGCAATCTAAGTCAGGCATATATCGAATGGGAACAACTAAAACAGGAAAAGGA
TAAACTTAAAGATTTACAGGTGAATCTGAGTAATAAGCTGCTTACCACACATAGCTGGGAGAAAAGTGCC
TGGATTTCCAGACTGCCCGGCAATATAACAATATGTCCAGTAGTACAGGAGTGA
 Primer design