SecReT6
Protein ID: 407696014
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02185
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2393958..2397710 [+]
Producttransmembrane protein
NoteTssM
UniProt IDK0CA65
KEGG IDadi:B5T_02185
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-71, Aligned region: 194..456
ImcF-related_N [PF14331], Evalue: 1.20E-71, Aligned region: 958..1016
IcmF-related [PF06761], Evalue: 5.80E-50, Aligned region: 500..837
DUF1215 [PF06744], Evalue: 3.30E-24, Aligned region: 552..578
DUF1215 [PF06744], Evalue: 3.30E-24, Aligned region: 980..1089
Protein Sequence: 1250 a.a.     [Download]
>gi|407696014|ref|YP_006820802.1| transmembrane protein [Alcanivorax dieselolei B5]
MSGMRKGLASLGAWLINYRLWAVLALVIGVFLLWRGGDPGSQIGFVLLIVALVLGLFTLIRWGIRRWRER
RATRDIDGLMNEQAERASRNAKAEDRGDIEEVRGRMQEAVKAIKSSRLGVLKGKAALYELPWHVIIGNPA
AGKSSAILNSGLKFPFEDNRNSVVQGIGGTRNCDWYFTAEGIVLDTAGRYSVGGEDRGEWLSFLDLLKKH
RPRAPINGIIIAASIAELSGNRPEFAIELARNLRQRVQEVTERLEVFAPVYVVFTKADLIAGFMSFFSGL
DPSEREKVWGATLPYDPQAQVDELSIFDQHFDELAEGLKEMGLSHMAMQRGREVAPGLLTLPLEFVSLKP
VLRTFIASLFEDNPYQFKPVFRGFYFTSALHEGETVLHASERIADEFSLAPRQDKDEPVNGKPDQAHFLK
DLFRKVIFADKELVRQYSSPYRTRTRYGAFLAGALVVAALLGTWAWSYTTNRQLVANASRDLQQAVQIQE
GRLDLQSRIDALLLLQDRLEQLRQYRRDGGITTAMGLYQGDNIEAALWREYFAGMDQVMVRPTRARLEEY
LGKVVANADQLSMEESREEPRTALYVPPSPKDPAEAYNALKAYLMLGDHGRVEQTHLANQLTRYWRGWLD
ANRGQMSHEDVARAAEKLMTFYVASAGKPGWPEIDTRVSLVNDTRQALRGVMQGQPAMERVFAQIKARAA
ARFSTITVNSLLAGGNGENLLNGSYAISGAFSREAWQDYIKDAIHEAANTQLNTTDWVLDTTEQSDLSLA
GSPEHIARQLTALYKQEYAAQWQRFLRGVSVAGFSSGFDDAASAMNRLGNNENSPLKALLQAVHEQTVWD
NPRALYARVSERSEQSSGIINWFKRVILRRAPAGMSGMSFEIDKKTGEAMLPPLGPVGKAFEGFAQLMEK
RSGQAPVIDAYFQALAATRSRLNDIKMAEVPGPGARTLMQETLSNQGSELSSALRLVDEQLLTGLGTEEK
QALRPLLLQPLTQTFAALVPAAENEINRTWQAQVYQPFDQGIGQQFPFDLSADDDAPKTEVAAIFGPSGA
IATFNKDALGSLVIQRGNVLTPRRWAGMGIRLSPELVSGYGDWVSGQSGGAGEADVTIFQILPAPAIGAV
EYVLEIDGQSLRYRNTPPQWETMQWPNRGATPGATLVATTSDGRRVQLADFPGENGFAQLMDAANLESRS
DSSTVTWSKGTVSISMEMRTVRRAGSGSDSDSWQRGLKLPRIVAGEGADERLVRQGGEDE
 
Nucleotide Sequence: 3753 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2393958-2397710 Alcanivorax dieselolei B5 chromosome, complete genome
ATGTCGGGGATGAGAAAGGGGCTTGCCAGCCTGGGCGCCTGGTTAATCAATTACCGATTGTGGGCGGTCT
TGGCACTGGTGATCGGGGTCTTCCTGTTATGGCGAGGCGGGGACCCGGGCAGCCAGATCGGCTTTGTGTT
GCTGATTGTGGCGCTGGTACTCGGGCTGTTCACCCTGATCCGATGGGGCATACGGCGCTGGCGCGAACGG
CGGGCCACCCGGGATATCGACGGTTTGATGAACGAGCAGGCCGAGCGGGCGTCACGCAATGCAAAGGCCG
AGGATCGCGGTGATATCGAGGAGGTGCGCGGCCGCATGCAGGAAGCGGTCAAGGCGATCAAATCATCACG
TCTGGGCGTTCTCAAAGGAAAGGCGGCGCTTTATGAGCTGCCGTGGCATGTGATCATCGGCAATCCGGCG
GCGGGGAAAAGCTCCGCCATTCTTAATTCCGGGCTCAAGTTTCCCTTTGAGGATAATCGCAACAGCGTGG
TGCAGGGGATTGGCGGCACTCGCAATTGCGACTGGTACTTCACCGCCGAGGGCATCGTGCTGGACACCGC
CGGGCGTTACTCGGTGGGCGGTGAGGATCGTGGTGAGTGGCTGTCTTTTCTCGACTTACTGAAGAAACAC
CGTCCGCGCGCCCCGATCAACGGCATCATCATCGCCGCCAGTATCGCCGAATTGTCCGGTAACCGTCCGG
AGTTCGCCATCGAGCTGGCCCGCAATCTGCGCCAGCGGGTGCAGGAGGTGACCGAGCGGCTGGAAGTGTT
CGCGCCGGTGTACGTGGTCTTTACCAAGGCCGATCTGATCGCTGGTTTCATGTCGTTCTTCAGCGGTCTG
GACCCGTCCGAGCGGGAGAAAGTGTGGGGCGCCACCTTGCCCTATGATCCCCAGGCGCAGGTGGACGAAC
TGTCGATCTTCGACCAGCATTTCGATGAGCTGGCGGAGGGGCTCAAGGAGATGGGGCTCTCTCACATGGC
GATGCAGCGGGGCAGGGAAGTGGCGCCGGGTTTGCTGACCTTGCCGTTGGAATTCGTCAGCCTTAAGCCG
GTATTGCGTACCTTTATCGCCAGTCTGTTCGAGGACAATCCGTACCAGTTCAAACCGGTGTTCCGTGGTT
TCTACTTCACCAGCGCCCTGCACGAAGGGGAAACGGTACTGCATGCCTCCGAGCGGATCGCCGACGAGTT
TTCCCTGGCACCGCGACAGGACAAGGACGAACCGGTAAACGGCAAGCCGGATCAGGCTCATTTTCTCAAG
GACCTGTTCCGCAAAGTGATCTTCGCCGACAAGGAACTGGTGCGCCAGTATTCCAGCCCTTACCGGACCC
GCACGCGCTATGGCGCTTTTCTGGCGGGGGCTTTGGTGGTGGCGGCTCTGCTGGGTACCTGGGCGTGGTC
CTACACCACCAACCGGCAATTGGTGGCGAACGCCTCCCGTGACTTGCAGCAGGCGGTTCAGATCCAGGAG
GGGCGGCTTGATCTGCAATCTCGCATTGATGCCTTGCTGTTGTTACAGGACCGTTTGGAGCAGTTGCGCC
AGTACCGCCGTGACGGCGGTATCACCACAGCCATGGGGCTTTATCAGGGCGACAACATCGAAGCCGCTTT
GTGGCGGGAATACTTCGCCGGCATGGATCAGGTGATGGTACGGCCGACCCGGGCCCGGTTGGAGGAATAC
CTGGGCAAGGTGGTGGCGAACGCGGACCAGCTGTCCATGGAAGAAAGCAGAGAGGAACCGCGCACGGCCT
TGTACGTGCCGCCCTCGCCAAAGGATCCGGCCGAGGCCTATAACGCGCTCAAAGCCTATCTGATGCTCGG
CGATCACGGGCGGGTGGAACAAACCCATCTGGCCAACCAACTGACCCGTTACTGGCGGGGTTGGCTCGAC
GCGAACAGGGGCCAGATGAGCCATGAGGATGTGGCGCGGGCGGCGGAAAAGCTGATGACGTTTTATGTCG
CCAGCGCCGGCAAGCCGGGGTGGCCGGAAATCGACACCCGGGTTTCTCTGGTCAACGATACGCGCCAGGC
ATTGCGTGGCGTGATGCAAGGGCAGCCGGCGATGGAGCGGGTGTTCGCCCAGATCAAGGCCCGCGCCGCC
GCGCGTTTCTCCACCATCACGGTGAATTCCCTGCTGGCCGGCGGCAACGGGGAGAATCTGCTGAACGGCA
GCTATGCCATTTCCGGGGCCTTTTCCCGGGAAGCCTGGCAGGACTACATCAAGGACGCCATCCACGAGGC
CGCCAATACCCAGCTCAACACCACGGACTGGGTGCTCGACACCACCGAGCAGAGTGACCTCTCTCTGGCC
GGCAGCCCGGAACACATCGCCCGCCAGCTCACCGCGCTCTATAAGCAGGAATATGCGGCGCAATGGCAGC
GCTTCCTGCGTGGCGTCAGCGTGGCGGGTTTCTCATCCGGTTTTGACGACGCCGCCAGCGCCATGAACCG
GCTTGGCAACAACGAAAACTCCCCGCTGAAGGCCCTGCTGCAGGCCGTGCATGAACAGACCGTCTGGGAT
AATCCGAGAGCACTGTACGCCCGGGTCAGTGAGCGGTCGGAGCAGAGCAGCGGTATCATCAACTGGTTCA
AACGCGTGATCCTGCGTCGTGCTCCGGCGGGCATGTCCGGAATGTCCTTCGAAATCGATAAAAAAACCGG
CGAAGCTATGCTGCCGCCGCTGGGGCCGGTGGGCAAAGCCTTCGAAGGGTTTGCTCAGCTGATGGAAAAA
CGGAGCGGGCAGGCCCCGGTCATTGATGCGTATTTCCAGGCTCTGGCGGCAACACGGTCCCGTCTGAATG
ACATCAAAATGGCGGAGGTGCCGGGCCCCGGCGCCCGTACGCTGATGCAGGAAACGCTGAGCAATCAGGG
CTCGGAGCTGAGCTCCGCCTTGCGGCTGGTGGACGAGCAGTTGCTCACCGGACTTGGCACGGAAGAGAAG
CAGGCGCTCAGACCGCTGTTGTTGCAACCGCTGACGCAGACCTTTGCGGCGCTGGTTCCGGCGGCCGAGA
ATGAGATCAATCGGACCTGGCAAGCTCAGGTATACCAACCGTTTGATCAGGGCATCGGCCAGCAATTCCC
ATTTGATCTGAGTGCCGATGACGATGCGCCAAAGACCGAGGTGGCGGCGATCTTCGGTCCCTCCGGTGCC
ATCGCCACCTTCAACAAGGACGCGCTGGGAAGCCTGGTAATTCAACGGGGCAACGTTTTGACACCCCGTC
GCTGGGCTGGAATGGGAATCCGTCTGTCACCCGAGCTGGTCAGCGGCTATGGCGATTGGGTGAGTGGTCA
GAGCGGTGGTGCCGGTGAAGCCGATGTCACCATCTTCCAGATCCTGCCGGCGCCGGCCATCGGCGCGGTG
GAGTACGTGCTTGAAATCGATGGCCAGTCGCTGCGTTACCGCAATACGCCGCCGCAATGGGAAACCATGC
AATGGCCCAATCGCGGCGCCACCCCGGGCGCCACCTTGGTGGCCACCACCAGCGATGGGCGGCGGGTACA
ACTGGCCGACTTCCCCGGAGAAAACGGCTTTGCTCAACTGATGGACGCGGCCAACCTGGAGAGCCGCTCG
GACAGCAGCACGGTGACCTGGAGCAAGGGTACGGTGTCCATTTCCATGGAAATGCGCACCGTGCGTCGGG
CGGGTTCCGGCAGCGACAGTGACAGCTGGCAGCGCGGATTGAAGCTGCCTCGAATCGTTGCCGGAGAAGG
CGCGGATGAGCGGCTTGTCCGCCAGGGAGGCGAGGATGAGTGA
 Primer design