SecReT6
Protein ID: 407710745
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06127
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2332654..2333433 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDK0DTQ8
KEGG IDbpx:BUPH_06127
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-57, Aligned region: 29..230
Protein Sequence: 259 a.a.     [Download]
>gi|407710745|ref|YP_006794609.1| type VI secretion system protein ImpK [Burkholderia phenoliruptrix BR3459a]
MSYAPSLFGGSTPAATPAPAAEPSYQVRSLLDLLYDGFFMLFLLKNGREPGDAHEFSQRIQQFLGDFERG
AKKLNASAEDVYASKFAFCAAIDESVLSSSFRIRTEWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAAR
LQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIAHMKGKRAPFAPHWPLPDQVAHRLKREVPLWS
IGAVFALVGLLAYLGLNTYLRDQTLRTLAPYSQVVKLGPQSATLTISLP
 
Nucleotide Sequence: 780 bp     [Download]
>gi|407708765|ref|NC_018672.1|:c2333433-2332654 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAGCTACGCGCCTTCACTTTTCGGCGGCAGCACGCCTGCCGCGACACCCGCGCCGGCGGCCGAGCCGA
GCTATCAGGTTCGCTCGCTGCTCGACCTGCTGTACGACGGCTTCTTCATGCTCTTTTTGCTGAAGAACGG
CCGCGAACCGGGCGATGCGCATGAATTCAGTCAGCGTATCCAGCAGTTTCTCGGCGACTTCGAACGCGGC
GCGAAGAAGCTCAACGCATCCGCGGAAGACGTGTATGCGTCCAAGTTTGCGTTTTGCGCGGCGATCGACG
AATCGGTGTTGTCCTCCAGCTTCAGGATTCGCACCGAGTGGGAGCGCCGCCCGCTGCAACTGGTGCTGTT
CGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAATGCCGCGCGCAAGGCGCCGCGCGC
CTGCAATCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTGGAAGGGC
CGGAGAAGCTCGCGTATCTGACCGCGCGCATCGGCGATGAAATCGCGCATATGAAGGGCAAGCGCGCACC
GTTCGCGCCGCATTGGCCGCTGCCCGATCAGGTCGCGCACCGTCTGAAGCGCGAAGTGCCGTTGTGGTCG
ATCGGCGCGGTGTTCGCGCTCGTCGGCCTGCTCGCCTATCTCGGCTTGAACACGTATCTGCGCGATCAGA
CGCTGCGCACGCTGGCGCCCTATTCGCAGGTCGTCAAGCTCGGGCCGCAATCGGCCACGCTGACGATCTC
GCTGCCTTAG
 Primer design