SecReT6
Protein ID: 407710746
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06126
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2333430..2334776 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDK0DY85
KEGG IDbpx:BUPH_06126
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|407710746|ref|YP_006794610.1| type VI secretion system protein ImpJ [Burkholderia phenoliruptrix BR3459a]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRDALGSNVLRVSELSLVFP
DGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYSQDSNAGFVARYVSEETPVADHFTD
AAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPVLHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFASLAHLYQHSALHPERLFQELLRLAGQLMT
FSKGYALSDLPAYRHDDPGPGFARLDTILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKIDDKTLFY
IAVSADMPTAELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPVRPGACYFSCEPRGGLYE
RMLQAQSAMIYAPSGINDLQLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|407708765|ref|NC_018672.1|:c2334776-2333430 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAGTTATTCCGCAAAAGTGCTCTGGGGAGAAGGCCTGTTTCTGCGGCCGCAGCATTTTCAGCGTCAGG
ACGCCTACCATGAGGCGCGCCTCTTCGAGTCGATTCAGGCCATCCAGCCGTACAACTGGGGCGTGCGCTC
TGCGCGCTTCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGCGTGAGCGAACTGTCGCTGGTGTTTCCC
GACGGCGCGCTCTACTCCGCGCCGCAGGCGGACGACCTGCCGCCGCCCATCGCGCTCGACACGCTGCCGG
ACGGCATCAACGAATTCACGTTTTATCTTGCGCTGCATCCGCTGCGCGAGACAGGCGCCAACTATTCGCA
GGACAGCAACGCGGGCTTCGTCGCGCGTTACGTGAGCGAAGAGACGCCGGTAGCAGACCATTTCACGGAC
GCCGCCGAAGCCGACATCACCTTTCTCAAGACGAGCGTCAAGCTGATCGCGCACAGCGAGCCGCGCGATC
AACTGCTCTCGGTGCCGCTCGTGCGCGTGCGCCGCACGGCCACCTCAGGCTTTGAAATCGACGACAGCTT
CGTGCCGCCCTGTCTCGCGATCGAGGCATCGCCGGTGCTGCATCAGCGGCTGCGCCAGTTGATCGACGCA
TTGCAGGCGAAAGTCAACGCGCTGTACGGCTTTCACCGCGAGCCGACCAAGAACATTATCGAGTTCCGTT
CCGGCGACATCGCGTCGTTCTGGCTGCTGCACACGGCAAGCGCGGCGTTCGCGTCGCTTGCGCATCTGTA
TCAGCATTCGGCGCTGCATCCGGAGCGCCTCTTTCAGGAATTGTTGCGCCTTGCCGGCCAACTGATGACG
TTCTCGAAGGGCTATGCGCTCTCCGATCTGCCGGCTTATCGCCACGACGATCCGGGGCCCGGCTTCGCGC
GCCTCGACACGATCCTGCGCGATCTGCTCGAAACGGTGATCTCCACGCGGTACTTTGCCATCGCGCTGGA
AGAAGTGCGCCCGTCGTTTCATGCGGGCCGGCTCGATTCGGGCAAGATCGACGACAAGACCCTGTTTTAC
ATTGCCGTGTCCGCGGACATGCCCACTGCCGAGCTCGTGGAAGCGGTGCCCGCGCGCTTCAAGGTGGGTG
CGCCCGACGATGTCGACAAGCTCGTGCTCTCGGCCATGCCGGGCGTGCGGCTCGTGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCTGGCGCCTGCTATTTCTCCTGCGAGCCGCGCGGCGGGCTGTACGAG
CGCATGCTGCAAGCGCAGTCCGCCATGATCTACGCGCCCTCGGGCATCAACGATCTTCAACTTGAACTGA
TCGCGGTCACCTCATGA
 Primer design