SecReT6
Protein ID: 407710747
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06125
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2334885..2335511 [-]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDK0DZT2
KEGG IDbpx:BUPH_06125
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-37, Aligned region: 19..180
Protein Sequence: 208 a.a.     [Download]
>gi|407710747|ref|YP_006794611.1| type VI secretion system protein VasD [Burkholderia phenoliruptrix BR3459a]
MNSRLVRHASLLIIEAAACALLGGCAAGVTVLGAAANAALQASGLGKPDVPDAQKPPRNVPLTLYAAPNL
NAANDKRPLALVVRLYVLKDPTSFQQAPFDAFTDATKEKTTLGGDLLGVREVTLIPGQRYIVTEKVSREA
QAFGIVALFRDPAMQRWKFAFDPAKSEKSGIMVGLHNCAMTVTNGTVIPPEQGLPAQPLNMLSSVSCG
 
Nucleotide Sequence: 627 bp     [Download]
>gi|407708765|ref|NC_018672.1|:c2335511-2334885 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAATTCGCGTCTTGTTCGCCATGCATCGTTATTGATTATAGAGGCCGCCGCATGCGCCCTTCTCGGCG
GTTGCGCCGCGGGCGTGACCGTGCTCGGAGCCGCGGCCAACGCGGCTTTGCAGGCAAGCGGCCTCGGCAA
GCCCGATGTGCCGGACGCGCAGAAACCGCCACGCAATGTCCCACTCACGTTATATGCGGCGCCGAATCTG
AATGCCGCGAATGACAAACGGCCATTGGCACTGGTCGTGCGGCTTTACGTGCTGAAAGACCCCACCTCCT
TCCAGCAGGCGCCATTCGACGCATTTACCGACGCCACAAAGGAAAAGACCACGCTGGGCGGCGATTTGCT
CGGCGTGCGCGAAGTGACGCTAATCCCGGGCCAGCGTTACATTGTTACCGAAAAGGTGTCGCGAGAAGCG
CAGGCATTCGGTATCGTCGCGCTATTCCGCGATCCGGCCATGCAGCGTTGGAAATTCGCCTTCGATCCGG
CGAAGTCGGAGAAATCCGGCATAATGGTCGGCCTGCATAACTGTGCAATGACCGTGACCAACGGCACGGT
GATCCCGCCGGAACAGGGATTGCCCGCGCAGCCGCTCAATATGCTTTCTTCGGTGAGCTGCGGTTAA
 Primer design