SecReT6
Protein ID: 407710749
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06123
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2336617..2337144 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDK0DXH3
KEGG IDbpx:BUPH_06123
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.20E-59, Aligned region: 11..163
Protein Sequence: 175 a.a.     [Download]
>gi|407710749|ref|YP_006794613.1| type VI secretion system protein ImpB [Burkholderia phenoliruptrix BR3459a]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVDNRLSEAGGKFAVDLRFKSMADFNPDEVVAQIEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTQQLQTLAKDHGGAPDHDKQGE
 
Nucleotide Sequence: 528 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2336617-2337144 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGGCGAAGAAAGAAAGCATACAAAAACGCTTGCAGAAAGTGCGGCCGCCCCGCGTGCAGCTCACCTATG
AGGTGGAGCGCGGCGATGCGATCGAAGTGAAGGAGCTGCCGTTCGTCGTCGGCGTGGTTGCCGATCTGGC
GGGGCAGTCGGAAGTCGAACAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAATTTC
GACGACGTCATGAAGGCGATCGAGCCGCGCGCTGCTTTTCAGGTGGACAACCGTCTAAGCGAAGCCGGCG
GCAAATTCGCAGTCGATCTGCGTTTCAAGTCGATGGCCGATTTCAATCCGGACGAAGTGGTCGCGCAAAT
CGAGCCGCTGCGGCGTCTGCTCGAAGCGCGCTCGAAGCTTGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTCTCCGAAGTGCTCAACAACACGCAGCAGCTGCAGACGCTGGCGAAAGACC
ACGGCGGCGCGCCGGATCACGACAAGCAAGGCGAATAA
 Primer design