SecReT6
Protein ID: 407710750
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06122
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2337159..2338649 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDK0DTR4
KEGG IDbpx:BUPH_06122
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.40E-190, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|407710750|ref|YP_006794614.1| type VI secretion system protein ImpC [Burkholderia phenoliruptrix BR3459a]
MNQQTAAAQLATAQSGAESTLLDEIVEKSRVAKSDSEHARAKDLIGELVREVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRMESTWRGLDYLCKESNTGATVKIKALHAPKRDLVRDFKTAIEFDQSA
LFKKIYEEEFGTFGGSPFGAIIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASASPELLGLETFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGATAEGFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
EVFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2337159-2338649 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAATCAGCAAACGGCAGCAGCTCAACTCGCCACTGCGCAAAGCGGCGCTGAATCCACGCTGCTCGATG
AGATCGTCGAGAAAAGCCGCGTGGCGAAGTCGGATTCCGAACACGCGCGCGCGAAAGATCTGATCGGCGA
ACTCGTGCGCGAGGTGCTCGACGGCACGGTGGTCGTCTCCGACAATCTGTCGGCCACCATCGACGCGCGC
GTTGCCGAACTCGACCGCCTCATTTCGGCGCAGTTGAGCGCGGTGATGCACGCGCCCGAGTTTCAGCGCA
TGGAAAGCACGTGGCGCGGGCTCGATTATCTGTGCAAGGAGAGCAACACCGGCGCCACGGTCAAGATCAA
GGCGCTGCATGCACCCAAGCGCGATCTGGTGCGCGACTTCAAGACCGCGATTGAATTCGACCAGAGCGCG
CTCTTCAAGAAGATCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGATCATCGGCG
ACTTCGAGGTCACGCGCCAGCCCGAAGACGTGTACTTTATCGAACAGATGTCGCACGTCGCAGCGGCCGC
GCATGCGCCGTTTATCGCGTCGGCGTCGCCCGAATTGCTGGGCCTTGAAACGTTTGCCGATCTCGGCAAG
CCGCGCGACCTCGGCAAAGTATTCGATACGGTTGAATACGCCAAGTGGAAGTCGTTTCGCGACTCGGAAG
ACTCGCGCTACGTCGGCCTCACGTTGCCGCGTTTTCTCGGCCGCCTGCCGTTCAATCCGAAAGACGGCGC
CACGGCGGAAGGCTTCAACTTCGTCGAGGACGTGGACGGCACAGACCACAGCAAGTACCTGTGGTGTAAC
GCGGCATGGGCGTTCGCCGCGCGTCTCACGGCCGCATTCGACGACTTCGGCTGGTGCGCCGCGATTCGCG
GCGTGGAAGGCGGCGGTCTGGTCGAAGATCTGCCCACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTGAAATGCCCGACCGAAATCGCGATTACGGACCGCCGCGAAAAAGAATTGAGCGACCTCGGCTTCATT
CCGCTCGTGCATTGCAAGAACTCCGACTACGCCGCATTCTTCGCCGCGCAATCGGTGCAAAAGCCCAAGA
AATACAGCACCGACAGCGCCAATGCCAACGCGGTTCTGTCCGCGCAATTGCAGTACATCTTCTCCGTATC
ACGCGTTGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCGGCGCAAAACGTG
GAAGTGTTCCTGAATCGCTGGATCTCGCAGTACGTGCTGCTGGACGACAACGCCACACAGGAACAGAAAG
CGCAGTTTCCGCTGCGCGAAGCATCGATTCAGGTGTCGGAGATTCCTGGTAAGCCCGGCGCCTATCGTTC
CGTCGCGTTTTTGCGCCCGCATTTCCAGCTCGACGAACTGTCCATTTCGTTGCGGCTCGTCGCCGATCTG
CCGAAACCGGCCAATTCATAA
 Primer design