SecReT6
Protein ID: 407710752
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06120
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2339310..2339789 [+]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDK0DZU1
KEGG IDbpx:BUPH_06120
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-22, Aligned region: 29..137
Protein Sequence: 159 a.a.     [Download]
>gi|407710752|ref|YP_006794616.1| type VI secretion system protein ImpF [Burkholderia phenoliruptrix BR3459a]
MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKSTVARDVEAILNTRIALTEHELAALPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVSVTLELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAKL
 
Nucleotide Sequence: 480 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2339310-2339789 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAAACGCTTCGAACCCAGCTTTCTCGACAAGCTGTTCGACGACGAACCGCATTTGCCGGCTTCCCCGG
CGATGCGGCAATTGTCGTTGGACGAATTGAAAAGCACGGTCGCGCGCGACGTCGAGGCAATATTGAATAC
GCGCATTGCGCTGACCGAGCACGAGCTGGCCGCTTTGCCCGAGTGTCAGCGCTCCGTGCTTACTTATGGT
CTGAACGACTTCGCAGGTCTGAGTCTCGCGAGTCACTATGACCGCACGTTCATCTGTAAATCGATTCAGC
AGGCCATTGCACGGCATGAGCCGCGCTTGCAGCAGGTATCGGTCACACTCGAACTGAACGAACAATCGAC
CAATGCGCTTTACTTCGCCATTCAGGCGCTGCTGGTCGTTCATCCGGCAGAAGAACCGGTGAGTTTCGAC
GCAATGTTGCAGCCTTCCACATTGCAATACTCGGTGACGCGCGCACGCGCGAAACTGTAA
 Primer design