SecReT6
Protein ID: 407710753
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06119
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2339900..2341738 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDK0E1Q0
KEGG IDbpx:BUPH_06119
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-215, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|407710753|ref|YP_006794617.1| type VI secretion system protein ImpG [Burkholderia phenoliruptrix BR3459a]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAMSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQLGTSAAVSHLTEPVVIERGTELKSRPIRGVQCRFRTAYDVTLAPLRI
SEAKYTSVAMAPSATVLPGNATAILSITFESTAAQLDLSALKVGTLRAHLHGEQSFIAALADCLFVNAMA
TYVEADRRGVWTPLRTPPLAQAGFDEHDALIDYPAKSHPAYRLLTEYFAFPDKFNFADFDLAAMTRTAGR
CQRLTLHVVLKEVRSDSHVARLLDALSAHHFRLFCTPVVNLFEQHGEPIRVNHQAVSYPVVAEARRAFAY
EVYSIDSVKLVRQQAHQESVTEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPA
APQTDTLSLDLTCTNRDLPAGLAVGLEGGDLFLEGGSLTGSIAMLRRPTPSVRFERGRAAHWRLISHLAL
NHVSLTNSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQRAAVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEILQCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2339900-2341738 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAACTGTCGTTTCTACGGCGCTATTCGCGCGATTTCGCCG
AGCGCTACCCGAAGATCGCGGCGCGTCTTGCCATGTCCGGCGAGCACTGCGAAGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCATTGCTCGGCGCGCGCATCAACAAGAAGCTCGATGACGACTACCCCGAGTTC
ACAGAAGCGCTGCTGGAAGTGCTGTACCCGCACTATCTGCGGCCCTTTCCCTCCTGTTCTATCGCGCAGT
TGGGCACTTCCGCGGCGGTGAGCCATCTGACCGAACCGGTTGTCATCGAGCGCGGCACCGAACTGAAGTC
GCGGCCCATTCGCGGTGTGCAGTGCCGTTTCCGCACCGCGTACGACGTCACGCTCGCACCGCTGCGCATT
TCCGAGGCGAAGTACACGTCGGTGGCCATGGCGCCGAGCGCGACGGTATTGCCGGGCAATGCCACCGCAA
TCCTGTCCATCACCTTTGAATCGACCGCTGCGCAACTCGACCTGTCTGCATTGAAAGTCGGCACATTGCG
CGCGCATCTGCATGGCGAGCAGTCGTTTATCGCAGCGCTGGCGGACTGCCTGTTCGTCAATGCAATGGCG
ACCTATGTGGAGGCGGACCGGCGCGGCGTGTGGACGCCATTGCGCACGCCGCCTCTCGCGCAAGCGGGTT
TTGATGAACATGACGCACTGATCGACTATCCGGCGAAATCGCACCCGGCTTACCGGCTTCTCACCGAGTA
CTTTGCCTTCCCGGACAAATTCAATTTCGCTGACTTCGACCTCGCGGCCATGACGCGAACCGCGGGCCGC
TGCCAGCGCCTCACGCTGCATGTGGTGCTGAAAGAAGTGCGCAGCGATTCGCATGTGGCGCGCCTTCTCG
ACGCGTTGTCCGCGCACCACTTCCGGCTCTTCTGCACGCCGGTCGTCAACCTGTTCGAGCAGCACGGCGA
GCCGATTCGCGTGAACCATCAGGCGGTCTCTTACCCGGTGGTGGCCGAAGCGCGCCGCGCCTTCGCATAC
GAGGTTTATTCCATCGATTCGGTGAAGCTCGTCAGGCAACAGGCGCATCAGGAATCCGTGACTGAGTTCC
GGCCGTTCTATTCGCTGCATCATGGAGAAGCCGCGCGCGCCGGACACTACTGGTTCGCGCGGCGCAACGA
TTGGGTTGCGCAAAAAAGCCCCGGCTACGAGACGGAGATTTCGATTGTCGACATCGACTTCGAACCGGCC
GCACCGCAAACCGATACGTTGAGCCTCGATCTCACCTGCACCAATCGCGATTTGCCCGCGGGGCTCGCGG
TGGGCCTCGAGGGCGGCGATCTGTTTCTGGAAGGCGGATCGCTGACCGGCAGCATCGCGATGCTGCGCCG
GCCGACGCCGAGCGTGCGTTTCGAACGGGGACGCGCGGCGCACTGGCGGCTGATTTCACATCTTGCGCTG
AATCACGTGTCTCTGACGAACAGCGGTCTTTCCGCGTTGAAGGAAATGCTGGTGCTCTACGATCTGCGGC
GCACGGCGGTATCGGCGCGGCATATCGACGGGCTTGTCGGAATCGAGCAGCGTGCGGCCGTGCAATGGCT
TCCCGGCAAACCGTTCGCGACTTTCGTGCGCGGCATAGAAATTCGCCTGACTATCGACGAAGAACATTTT
GTGGGTACGAGTCTCGCGTCGTTCGTGCGAGTGATCGATACATTCTTCGGGCTGTACGTGCATCTGAACA
GCTTTGTGCAACTGGTCGTCGTGTCGAAACGCACGGGCGAGGAGATCTTGCAATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG
 Primer design