SecReT6
Protein ID: 407710754
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06118
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2341786..2342796 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDK0DXH7
KEGG IDbpx:BUPH_06118
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-87, Aligned region: 1..317
Protein Sequence: 336 a.a.     [Download]
>gi|407710754|ref|YP_006794618.1| type VI secretion system protein ImpH [Burkholderia phenoliruptrix BR3459a]
MRVLEKWFAQQAPSATGRSGDIVAQRIAFRNSLSMSFPPSEIHGAQSYDDNGAALKEKPQRTEALESGLL
DKVDITPAFFGLLGGQGALPLHYTEQIIAREQIKRDRAAREFFDVFSNRATALFYAAWKKYRLPFHYELD
RDERYLPLLLALAGVSDNDTRSTLQSGDGALFDEAIAGYALPARHRPVSAAYLQRTLSDYFKVPVRVEQF
VGKWYDVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLVIGPLDKADYEAFLPGADRAVALERMLTL
LAGVTLEYEVSLVLRREAVGPTLLSQGARLGWDAFLSTRDAERDRTDARYELHVIH
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2341786-2342796 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
GTGCGCGTGCTCGAGAAGTGGTTCGCACAGCAAGCGCCGTCGGCCACCGGCAGATCCGGCGACATCGTCG
CGCAGCGCATTGCCTTTCGCAATTCGCTGTCCATGTCATTTCCGCCGAGCGAAATTCACGGCGCGCAATC
CTACGACGACAACGGCGCCGCGCTAAAGGAAAAGCCGCAGCGCACGGAGGCGCTCGAAAGCGGCTTGCTC
GACAAAGTGGACATTACGCCGGCGTTTTTCGGTTTGCTCGGCGGGCAGGGCGCGTTGCCGCTGCATTACA
CCGAGCAGATCATCGCGCGTGAACAGATCAAGCGCGACCGCGCCGCGCGCGAGTTCTTCGATGTCTTTTC
GAATCGGGCCACTGCGCTCTTCTATGCGGCGTGGAAAAAGTACCGCTTGCCGTTCCACTACGAACTGGAT
CGCGACGAACGCTATTTGCCATTGCTGCTTGCGCTTGCCGGCGTATCCGACAACGACACCCGCAGCACCC
TGCAAAGCGGAGACGGTGCGCTGTTCGACGAAGCGATTGCAGGCTATGCACTGCCCGCGAGACACCGGCC
CGTTTCGGCGGCCTACTTGCAACGCACGCTGTCGGACTACTTCAAGGTACCGGTGCGCGTCGAGCAGTTC
GTTGGCAAATGGTATGACGTACCGCGCGATCAATTGACCGTACTCGGCAGTGTCAACGCGACACTCGGCG
CAACGGCGCTGGCGGGCGAGCGCGTGTGGCAGCGCGACATGCGGGCACGGCTCGTCATCGGCCCGCTCGA
CAAGGCGGATTACGAGGCCTTTCTGCCGGGCGCCGATCGCGCGGTGGCACTCGAACGCATGCTGACGCTG
CTCGCCGGCGTCACGCTCGAATACGAAGTGTCGCTAGTGCTGCGACGCGAGGCGGTGGGGCCGACGCTGC
TGAGTCAAGGCGCGCGCCTTGGCTGGGACGCTTTCCTCTCGACGCGCGACGCCGAGCGCGACCGCACCGA
TGCCCGCTACGAACTGCATGTGATTCACTGA
 Primer design