SecReT6
Protein ID: 407710756
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06116
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2345541..2346659 [+]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDK0DYA3
KEGG IDbpx:BUPH_06116
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.90E-25, Aligned region: 55..116
Protein Sequence: 372 a.a.     [Download]
>gi|407710756|ref|YP_006794620.1| type VI secretion system protein ImpA [Burkholderia phenoliruptrix BR3459a]
MPINLNTLLAPITEAAPCGEDLLFSADFDAIQHARRFEDPSLDQGEWVTDIKEADWPFVVERSSALLQTQ
TKDLRLAVWLTEALAIEEGITGLTQGYALLTGLCEKYWDAVHPLPEGDDTEYRLGNVAWLVGRTGDLLRA
MPLTSSQGNVYSTIDWDVAAHVAQAVKRDPDHADDIARGKPSIEQIDASKRATPPAFYSTLLAELKAFEA
AMLALEQELDRRAADSAPSFRQARDAYESVFRLAERFARELGVNIQAQQAPASGASAATSHEHERAEPTF
KTSLQREEPVLTPTPTTAIAGIQSRAHAVAQLRAVARFFRSTEPHNPAAYFADKAAEAADMPLHQWLSTV
VKDDGSLAHIRELLGVKPEENS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2345541-2346659 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGCCGATCAACCTGAACACGCTGCTTGCTCCCATTACAGAGGCTGCGCCCTGCGGCGAAGATCTGCTCT
TTTCCGCCGATTTCGATGCGATCCAGCACGCGCGGCGTTTTGAAGACCCGTCGCTGGATCAAGGCGAATG
GGTCACCGACATCAAGGAAGCCGACTGGCCTTTCGTGGTGGAGCGCTCCAGTGCGTTGCTGCAGACGCAG
ACCAAAGACTTGCGCCTCGCGGTCTGGCTCACGGAAGCACTCGCCATCGAGGAGGGCATAACCGGCCTCA
CACAGGGATACGCGCTGCTGACCGGGTTGTGCGAAAAGTATTGGGATGCAGTCCATCCGCTGCCGGAGGG
CGACGATACCGAGTACCGCCTCGGCAATGTGGCGTGGCTCGTGGGACGAACCGGCGATCTGCTGCGTGCG
ATGCCGCTGACGTCGTCGCAAGGAAACGTGTACAGCACAATTGACTGGGACGTCGCCGCGCACGTTGCGC
AAGCCGTGAAGCGCGATCCCGATCATGCCGACGACATCGCTCGCGGCAAGCCTTCCATTGAGCAGATCGA
CGCGTCAAAGCGTGCCACGCCCCCCGCGTTTTACTCGACGTTGCTGGCCGAGCTGAAGGCTTTCGAAGCG
GCGATGCTCGCGCTGGAGCAGGAGTTGGACCGCCGCGCTGCCGACTCCGCGCCGAGCTTCCGTCAAGCCA
GGGACGCGTATGAAAGCGTGTTCCGTCTTGCCGAACGCTTTGCGCGCGAGCTGGGCGTGAATATCCAGGC
GCAGCAGGCGCCCGCCAGTGGCGCGAGCGCGGCGACGTCCCATGAACACGAACGTGCGGAGCCCACGTTC
AAAACCTCACTGCAACGCGAGGAGCCTGTGTTGACCCCTACGCCGACCACCGCCATTGCAGGAATCCAGA
GCCGCGCGCACGCGGTCGCCCAGTTGCGTGCCGTGGCGCGGTTCTTTCGCAGCACGGAGCCCCACAATCC
GGCTGCATACTTCGCCGACAAAGCTGCGGAGGCCGCCGACATGCCGCTGCACCAGTGGCTCTCCACGGTG
GTGAAAGACGACGGGTCGCTCGCGCATATACGCGAGCTGCTGGGTGTGAAGCCCGAAGAAAACAGTTAG
 Primer design