SecReT6
Protein ID: 407710757
SecReT6 ID705
T6SS typei4b
Gene symbolompA
Locus tagBUPH_06115
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2346758..2347660 [-]
ProductOuter membrane protein A
NoteTagL
UniProt IDK0DZU8, K0DZU8
KEGG IDbpx:BUPH_06115
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.70E-26, Aligned region: 136..168
OmpA [PF00691], Evalue: 3.70E-26, Aligned region: 198..292
BON [PF04972], Evalue: 4.60E-05, Aligned region: 71..109
BON [PF04972], Evalue: 4.60E-05, Aligned region: 146..159
Pilus_CpaD [PF09476], Evalue: 0.00034, Aligned region: 194..277
Protein Sequence: 300 a.a.     [Download]
>gi|407710757|ref|YP_006794621.1| Outer membrane protein A [Burkholderia phenoliruptrix BR3459a]
MGLVTPLAHADNDGPARVTPVDNSSMSIRTTALPSASSGAPALNTAGLASGTTGAGTGAVTASPPPANAT
PGQVVVGGKVPDEATKAAVLARLRDTYGAANVVDQIEVADVATPPNWSANVQKLIGPQLKQISKGQLKID
GTQIDVKGEVRNESQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFETGSATLTPQGR
AILDQMAAAMQKMTTKTVAIIGHTDNSGNRASNIALSQARADAVKGYLVAKGIPPQQMSTTGVGPDQPIA
SNDTADGRARNRRIEFRAGS
 
Nucleotide Sequence: 903 bp     [Download]
>gi|407708765|ref|NC_018672.1|:c2347660-2346758 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
GTGGGCCTGGTCACCCCGCTCGCTCACGCCGACAACGATGGCCCGGCTCGCGTCACGCCGGTCGACAACA
GCAGCATGTCGATTCGCACGACGGCGCTGCCCTCCGCTTCGTCCGGTGCGCCTGCGCTCAACACCGCGGG
CCTCGCGAGCGGCACGACCGGCGCCGGCACCGGCGCGGTGACGGCGTCGCCGCCGCCCGCCAACGCGACG
CCGGGCCAGGTCGTGGTCGGCGGCAAGGTGCCCGACGAAGCCACCAAAGCCGCTGTGCTCGCGCGTTTGC
GCGACACGTATGGCGCGGCTAACGTCGTCGATCAGATCGAGGTCGCCGACGTCGCGACGCCGCCGAACTG
GTCCGCGAATGTGCAAAAGCTGATCGGCCCGCAACTCAAGCAGATCAGCAAGGGGCAGTTGAAAATAGAC
GGCACGCAGATCGACGTGAAGGGCGAAGTGCGCAACGAGTCGCAACGTCAGCAACTCGCGAGCGACATGG
CGAATGCGCTGAATCCCACTTATACGATCAAGAACGGCTTGCGCGTGAGTGCCTCCGAGCAGGGCCTGCT
CGACCAGACGCTCGCCAATCGCACGATTGAATTCGAAACCGGCAGCGCGACGCTCACGCCGCAAGGCCGC
GCGATTCTCGACCAGATGGCGGCGGCCATGCAGAAGATGACGACAAAGACCGTCGCGATCATCGGTCACA
CGGACAACTCGGGCAACCGCGCGTCGAATATCGCGCTGAGCCAGGCACGCGCCGATGCCGTGAAGGGTTA
CCTCGTCGCCAAGGGCATTCCACCGCAGCAGATGAGCACGACGGGCGTCGGCCCCGACCAGCCGATCGCG
TCGAACGATACGGCGGACGGACGCGCGCGCAACCGGCGTATCGAGTTTCGCGCGGGGTCCTAA
 Primer design