SecReT6
Protein ID: 407710759
SecReT6 ID705
T6SS typei4b
Gene symbol-
Locus tagBUPH_06113
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2348717..2352592 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDK0DXI1
KEGG IDbpx:BUPH_06113
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.80E-71, Aligned region: 190..451
IcmF-related [PF06761], Evalue: 9.10E-55, Aligned region: 495..847
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 979..1094
Protein Sequence: 1291 a.a.     [Download]
>gi|407710759|ref|YP_006794623.1| type VI secretion system protein ImpL [Burkholderia phenoliruptrix BR3459a]
MRRFLNVLTHPRTLSIIGLLALAAVLFVGADTLQIDLMWPAIALAALVALWLLVWVVRRLRARRANDKLG
EMLEQQAEKQSADAGPAPTPARQAELDVLRTRLVDAVKTIKTSKIGQLSGGSALYELPWYIVIGNPAAGK
SSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRTEWLGFLGLLKKFRPK
APINGIIVTASIAELTSSKPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRH
EYDRVWGATLPYEPDEKRDVVGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALR
AFLATLFETNPFQYKPIFRGFYFTSALQEGETSSAAATRIANRFGLSAESMPKPHSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRMRYSTFFGFVAVLALALGGWTWSTVNNQQLAENVKADLDNVVRLQQNRND
LQSRLQAMDVLEDRIDQLEQFRRDKPLAVSLGLYQGDRLEQRLLTEYYNGVRQILLDPVSQNLASFLKDV
NAHPDQLAPLNRTPDAAAIPVSTHSAMTASGQGGLYSDASPTNVEDAYNALKTYLMLSDKRHVETAHLTD
QVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQ
RVYEEIKARASTRFAPMTIARIVGENNTALVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLN
TSAHDDLTLEGSPEQIQKALVMMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIGQEFSALGRIV
QTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSELADSLKYVDEQMLTGLTDSQ
RKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQNSLASKYPFAGDAKVEAGAGEIAQVFGPDG
SIAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQI
LPQPSSGTTEYTLAIDGQQMRYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLI
NSAQRKRRPDGTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAANSVAA
TNTASSAAPVASAVPAARPATAAVSNTGGAQ
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|407708765|ref|NC_018672.1|:c2352592-2348717 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGCGACGCTTTCTCAACGTGTTGACCCATCCACGCACGCTCTCGATCATCGGCCTGCTCGCGCTCGCTG
CGGTCCTCTTCGTCGGCGCCGATACACTGCAGATCGACCTGATGTGGCCGGCCATCGCGCTCGCTGCGCT
CGTCGCGCTATGGCTGCTCGTATGGGTGGTGCGCCGCCTGCGCGCGCGTCGCGCGAACGATAAACTCGGC
GAAATGCTCGAGCAGCAGGCGGAAAAGCAGAGCGCCGACGCGGGACCGGCGCCCACGCCGGCGCGCCAGG
CGGAACTCGACGTGCTGCGCACGCGCCTCGTCGACGCGGTCAAAACCATCAAGACTTCGAAGATCGGCCA
GCTGTCGGGCGGCTCGGCCCTGTATGAACTGCCGTGGTACATCGTGATCGGCAATCCCGCCGCGGGCAAA
AGCAGCGCCGTGCTGAACTCGGGCTTGCAATTCCCGTTCGCCGACAAAAACAACGCGGTGATCCACGGCA
TTGGCGGCACGCGCAATTGCGACTGGTTCTTCACGACAGAGGGCATTCTGCTCGACACGGCAGGACGCTA
CTCCGTGCATGAGGAAGACCGTACCGAATGGCTCGGGTTTCTCGGCCTGCTCAAGAAGTTCAGGCCCAAA
GCGCCGATCAACGGCATCATCGTGACCGCGAGCATTGCGGAACTCACCAGCAGCAAGCCTGAATTCGCCA
TCAATCTTGCGAAGAACCTGCGCCAGCGCGTGCAGGAATTGACCGAAAAGCTGGAGGTGTTCGCGCCGGT
CTACGTGATGTTCACCAAGGCCGACCTGATCACAGGCTTCACCGAATTCTTCAGCGGCAGCGACCGTCAC
GAATACGACCGCGTGTGGGGTGCCACCCTGCCCTACGAGCCGGACGAAAAGCGCGACGTGGTCGGCCTTT
TCGACGAACACTTCGAAGAACTCTATGACGGCCTGAAAGAAATCAGCGTCGCGCAGATGTCGATCAACCG
CGGCAACAAGCTCTCGCCGGGCCAACTGAGCTTCCCGCTCGAATTCTCCACGATCAAGCCCGCGCTTCGC
GCCTTTCTCGCCACGCTGTTTGAAACGAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTATTTCA
CGAGCGCCTTGCAGGAAGGCGAAACCAGCAGCGCCGCGGCCACGCGCATCGCGAACCGCTTCGGCCTGAG
CGCCGAAAGCATGCCGAAGCCGCACAGCGCGTTCTCAAAGAACGGGTTCTTCCTGCGCGACCTCTTTTCC
AAGGTCATTTTCGCGGACCGGCAAACGGTCAGGCAATTCGCCAGCCCCGCGAAGACGCGCATGCGCTATT
CAACGTTTTTCGGCTTCGTCGCCGTGCTCGCGCTGGCGCTCGGCGGCTGGACATGGTCGACCGTCAACAA
TCAGCAACTCGCGGAGAACGTCAAGGCCGATCTCGACAACGTCGTGCGTTTGCAGCAGAACCGCAACGAC
CTGCAATCGCGACTGCAGGCAATGGACGTGCTCGAAGACCGTATCGATCAGCTCGAACAGTTCCGCCGCG
ACAAGCCGCTCGCTGTTTCGCTCGGCCTGTATCAGGGCGATCGTCTCGAACAGCGTCTTCTGACCGAGTA
CTACAACGGCGTGCGTCAGATTCTGCTGGATCCGGTTTCGCAGAACCTCGCGTCGTTCCTGAAGGACGTC
AACGCGCATCCGGATCAGCTCGCGCCGCTCAATCGCACACCGGACGCCGCCGCGATTCCCGTCTCGACGC
ATAGCGCCATGACGGCGAGCGGCCAGGGTGGCCTTTACAGCGACGCGTCGCCTACCAATGTGGAAGACGC
ATACAACGCGCTCAAGACGTACCTGATGCTCAGCGACAAGCGTCACGTGGAAACGGCTCACCTGACCGAC
CAGGTGGCGCGTTTCTGGCGCGGCTGGCTCGAAACGAATCGCGGCAACATGCCTCGCGACGAAATGATCC
GCAGCGCCGAGCGCATGATCACCTTCTACCTGTCCCGCGTGTCCGACGACGACTGGCCGATGATCGACCA
GAACCTCGGCCTCGTCGATCAGACTCGCGAGAACCTGCGTCGCGTGGTGCGCGGCATGCCGGCGCGTCAG
CGCGTCTATGAGGAGATCAAGGCGCGCGCCTCCACCCGCTTTGCGCCGATGACCATCGCGCGCATCGTCG
GTGAGAACAATACGGCGCTCGTGGCGGGCAGCTACGCGATTCCCGGCACATTTACGCGGGAAGCGTGGTT
CCAGTATGTGCAGCCCGCGATTCGCGAGGCGGCGACGAAGGAATTGCAGGCGAAAGACTGGGTGCTCAAC
ACCTCCGCGCATGACGACCTGACGCTCGAAGGCAGCCCCGAGCAGATCCAGAAAGCACTGGTCATGATGT
ACAAGACCGAGTATGCAATGCACTGGCAGAAGTTCATGCAAGGCATCGCGGTGCAGAGCTTCGGCAGCTT
CGGGCAGGCTGTGGACGCGATGAACCGCCTCGGCGACCCGCAGGATTCGCCGATCCGCAAAGTACTCGAA
ACGGCGTATGACCAGACTTCGTGGGACAACCCGTCGCTCTTCAACGCGAGCCTGAAACGCGCGCAAAGCG
GCGTGACGAGCTGGTTCAAGCAATGGTTCTCGCGCGCGCCGACCGGCCAGCTGAACGCGAACATCGACAT
CAACGGCAATCCGGTGGAAATGCCGATGGGTCCCATCGGACAGGAATTTTCCGCGCTGGGGCGTATTGTC
CAGACGGGCGACAACGGCTCGATGCTCAAGGGCTATATGGACACGTTGTCCAAGGTCCGCACGCGCTTTA
ACGTCATCAAGAACCAGGGCGATCCGGGACCGGGCGCGCGTCAGCTCATGCAGCAGACGCTCGACGGGAG
CGGCTCCGAACTCGCGGATTCGCTCAAGTATGTCGACGAGCAGATGTTGACGGGCCTCACCGATTCGCAG
CGTAAAGCCCTGCGTCCGCTGCTCGTACGCCCTTTGATGGCCGCGTACGCCGTGGTGATCCAGCCTGCCA
GCGTCGAAGTCAACAAGGTTTGGAATGCACAGGTGTACCAAACATTCCAGAACTCGCTCGCCAGCAAATA
TCCGTTTGCCGGCGACGCGAAGGTGGAAGCCGGTGCTGGTGAAATCGCACAGGTGTTCGGACCGGACGGC
TCGATTGCGAAGTTCGTCGGGACCACGCTCGGGCCGCTCGCGGTGCGCCGCGGCGACACGCTGACAGCGC
GCACATGGGGCGACATGGGCCTCGCGCTCACGCCGGACTTCACGAATGGGTTCGCGCGCTGGGTCGCGCC
GCTTGCGGGCGGTGCAGCGGGCGCCTCGGCAGGCCAGAGCTCGGCGGAACCGCAGACCGTGTTCCAGATC
CTGCCGCAGCCGAGCAGCGGCACGACCGAGTACACGCTCGCCATCGACGGCCAGCAGATGCGTTACCGCA
ACACGCCGCCGCAATGGACCAACTTCGTGTGGCCGAATCCGTCGGGGTCGCCCGGCGCCACGCTATCGGC
CACGACCTTCGACGGACGCACCTTGCAACTCGTCAACGAACCGGGCCGCTACGGTCTCGAGAAGCTGATC
AATTCGGCGCAGCGCAAGCGTCGCCCGGACGGCACCTTCGATCTGTCGTGGACGCAAGGCAACGTGACGG
TGGCGGTCAGCATGCGCATCATCAGCACGTCGCAAGCCTCGGGCGGCAGCAGCGACGCGCCGCAGCAGCA
AAGCCTGCGTGGGCTGCGTCTGCCTTCTTCGGTGGCGGACGTAAGCGCGGCGGCCAATTCCGTCGCTGCC
ACGAACACAGCCAGTAGTGCGGCGCCCGTCGCGTCGGCGGTGCCGGCGGCGCGGCCGGCCACGGCCGCGG
TTTCGAACACAGGAGGTGCGCAATGA
 Primer design