SecReT6
Protein ID: 407712938
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_06575
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1371709..1375293 [+]
Producthypothetical protein
NoteTssM
UniProt IDK0DH49
KEGG IDbpx:BUPH_06575
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-77, Aligned region: 420..740
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 247..265
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 474..504
DUF1215 [PF06744], Evalue: 2.90E-35, Aligned region: 880..998
Protein Sequence: 1194 a.a.     [Download]
>gi|407712938|ref|YP_006833503.1| hypothetical protein BUPH_06575 [Burkholderia phenoliruptrix BR3459a]
MNKNKSRPAALFIGFSLAILFAICAVAVWLVAREQKWILDRLLIVELLLFIGLLISLIFTKYFEALLLWL
ASLRATQWLMQYDKRKQSEMSEGTTGTSQSLANALTGRNGRRWRYRQRWVLVAGDEPLVKRLVPDLVDTG
YAIAGSTVLLYAKQTSNTLDTNWLDQIRRLRGRRPVDAIVAVTRDRASVASPFDADGLAQCLARHARALG
WAAPAYLLNVTDFGAELEGQDEAIGLTWSNPRINADDVDTSLKDLSRVLAESGVVRIARDKHDRYPAELS
QHIERLGTALSGLVPQTANSRSWRQSVHGLLFAPLFKEHELASPSLVQNADGDADDPAEANPPGQRQRAI
WQTIADHSRKIHGRRIGFPLSATAAWITTALLASWIAGTMLSGFVNRATIRHAADTVAQLSTVQDRTPAL
QTLHGLDRQIDTLEIHQREGAPWTARFGLNRDGALLEALWPGYASAASRILVAPIRQRLEERLRQLASLS
DAEIASGGNAQVQAAYDTLKAYLMLAKPERAIAAFLTPQLVATAAPGRPANSPLSSGTWDDLRQHTIAFF
ADHLGRASMPAMSPDAGLVASTRQTVIGVRGIQNSTDAIYQQILDEARAKYPPVSLATLLGDTSSRGLFN
STATVPGVFTRAAWDERLAKAIDDASEQHDVSGDWVLSDVKATQAAPSTLKAELRQRYFDDYARAWALFL
NSLRWQPAPTLSATADQLTLLGDPQRSPLVALMNAVVYQAGAGANTQSLAGNLISKAQQLVGGGEKDPSK
QTPPQPAPLAAAFGPILHLAGRDLMGSDLASGAPANSKTAAQLAVTGDLSLARYLERVTAMRLKASQIVS
GADPDAMARLAAQSVLQGRTSDLAGSRDYASRLAASLGEQWSGFGELFQAPFDQAWQVVVQPAASSLNEI
WRSAIVADWNRTFGGRYPFADSGNDASLPEMARFMRPDNGVIAQFVTTQLAGVVERQGDRWVVAQGGNHG
ALSIDPGFLSSLNRLTQISSVLFPSGDAHVRFELQAVPFSGITEMKFVLSGRELHYFNQKQEWMPFEWPG
QSLENLSHIEWQTEQGGLRTALDAQGRFGLIRLLERARVMQQDSARFLLTWSPETSEGIALKVQLRSEAG
AGPLDVLQLRHFMLPTRVFVTGAANGAVNGAVNGVPKRLATALPAQPPPLPPAAMAAARHAGTPLPYGAL
PEVE
 
Nucleotide Sequence: 3585 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1371709-1375293 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGAACAAAAACAAGTCACGTCCCGCTGCGCTTTTTATTGGTTTTTCTCTCGCAATTCTCTTTGCCATTT
GCGCCGTTGCCGTGTGGTTAGTCGCGCGTGAGCAGAAGTGGATTCTCGACAGACTGCTCATTGTCGAGCT
ATTGCTCTTCATAGGCCTGTTGATATCGCTGATCTTTACGAAATACTTCGAGGCTCTATTGCTCTGGCTT
GCTTCGTTGCGGGCGACGCAATGGTTAATGCAATATGATAAGCGAAAGCAATCTGAGATGTCAGAAGGCA
CGACCGGAACATCACAGTCACTTGCGAATGCGCTGACGGGCCGGAACGGCCGACGCTGGCGTTACCGTCA
GCGCTGGGTACTTGTCGCAGGCGACGAACCACTCGTCAAGCGTCTGGTCCCGGACCTTGTAGATACCGGC
TACGCAATCGCCGGCAGCACCGTCCTGCTTTACGCAAAGCAAACCAGTAACACACTGGATACGAACTGGC
TGGACCAGATCCGTCGGCTACGTGGGCGACGTCCGGTCGACGCAATCGTGGCCGTGACGCGCGACCGTGC
CTCGGTAGCGTCTCCGTTCGACGCCGACGGACTCGCGCAGTGCCTTGCTCGCCACGCGCGCGCGCTGGGG
TGGGCAGCACCTGCATATCTTCTTAACGTGACAGACTTTGGTGCCGAGTTAGAGGGCCAGGATGAAGCGA
TTGGCTTGACTTGGTCGAATCCGCGCATCAATGCTGACGATGTTGATACATCACTGAAAGATCTTAGCCG
CGTCTTGGCGGAGTCAGGCGTCGTGCGTATCGCGCGCGACAAGCACGACCGCTATCCGGCCGAACTCTCG
CAACATATCGAAAGACTCGGCACCGCCCTATCGGGACTTGTCCCGCAAACAGCCAACTCGCGCTCCTGGC
GCCAGTCTGTTCACGGTCTTCTGTTCGCGCCGTTGTTTAAGGAGCATGAGCTTGCCTCCCCATCATTAGT
GCAGAACGCTGACGGCGACGCAGACGACCCGGCAGAGGCAAATCCCCCCGGCCAGCGCCAACGAGCGATC
TGGCAAACCATCGCCGACCACAGCCGTAAGATTCACGGCCGCCGCATTGGTTTCCCGCTGTCTGCAACAG
CCGCGTGGATAACCACGGCCCTGCTCGCCAGCTGGATCGCCGGCACAATGCTGTCGGGCTTCGTGAACCG
GGCAACGATCCGCCACGCGGCCGACACCGTCGCGCAGCTGTCCACCGTCCAGGATCGGACGCCGGCCCTG
CAAACCCTCCACGGCCTCGACCGGCAGATCGATACGCTGGAGATCCATCAGCGCGAGGGCGCGCCGTGGA
CGGCGCGTTTCGGCCTGAACCGTGACGGCGCCCTGCTCGAGGCGCTGTGGCCGGGCTACGCCAGTGCGGC
GAGCCGCATCCTCGTTGCGCCGATCCGCCAGCGGCTCGAAGAACGCCTGCGCCAGCTTGCGTCGCTGTCG
GATGCGGAGATCGCCAGCGGTGGCAATGCGCAGGTACAGGCCGCCTACGACACGCTCAAGGCTTACCTCA
TGCTCGCGAAGCCCGAGCGGGCAATCGCCGCCTTCCTGACGCCCCAACTGGTCGCGACGGCCGCGCCCGG
GCGTCCCGCGAACTCGCCCCTGTCGTCCGGCACCTGGGATGACCTGCGCCAGCACACGATCGCATTCTTC
GCAGACCACCTCGGTCGCGCCAGCATGCCCGCGATGTCGCCGGATGCTGGCCTGGTCGCCTCGACGCGCC
AGACGGTCATCGGCGTGCGCGGCATCCAGAACTCAACCGACGCGATCTACCAGCAGATCCTCGACGAGGC
GAGGGCGAAGTATCCGCCCGTGTCGCTCGCGACACTGCTCGGCGATACGAGCAGCCGCGGCCTCTTCAAC
TCGACGGCGACCGTGCCGGGCGTGTTCACGCGTGCCGCGTGGGACGAGCGCCTCGCGAAGGCGATCGACG
ACGCGAGCGAGCAGCACGACGTTTCAGGTGACTGGGTGCTGTCCGACGTGAAGGCGACACAGGCCGCACC
GTCAACGCTCAAGGCCGAACTTCGCCAACGCTACTTCGACGATTACGCCCGCGCGTGGGCGCTGTTTCTC
AACAGCCTTCGCTGGCAGCCGGCGCCGACGCTGTCCGCGACGGCCGACCAGCTGACGCTGCTGGGCGACC
CGCAGCGCTCGCCGCTCGTCGCGCTGATGAACGCGGTTGTGTACCAGGCAGGCGCGGGCGCGAACACCCA
GTCGCTCGCCGGGAACCTGATCAGCAAGGCGCAGCAGCTCGTCGGAGGCGGGGAGAAGGATCCGTCGAAG
CAGACCCCGCCCCAGCCTGCGCCGCTGGCTGCAGCGTTTGGGCCGATCCTGCACCTCGCCGGTCGAGACC
TCATGGGCAGTGATCTGGCGTCCGGTGCGCCAGCAAACAGCAAGACCGCCGCGCAACTCGCTGTGACCGG
GGACCTGAGCCTCGCGCGATACCTGGAGCGGGTCACGGCGATGCGCCTGAAGGCATCGCAGATCGTCTCC
GGCGCCGATCCGGATGCGATGGCGCGCCTCGCTGCGCAGTCGGTGCTGCAGGGCAGGACGTCCGACCTGG
CCGGGAGCCGCGACTACGCGAGCCGCCTGGCCGCGAGCCTGGGCGAGCAGTGGTCGGGCTTCGGCGAACT
GTTCCAGGCCCCGTTCGACCAGGCCTGGCAGGTCGTCGTGCAGCCGGCGGCATCGAGTCTGAACGAGATC
TGGCGCAGCGCGATCGTGGCGGACTGGAACAGGACGTTCGGCGGGCGCTATCCGTTTGCCGATTCCGGCA
ACGATGCGTCGCTGCCTGAGATGGCGCGCTTCATGCGGCCGGATAACGGCGTGATCGCGCAGTTCGTCAC
GACGCAGCTCGCGGGGGTGGTCGAGCGGCAGGGCGACCGGTGGGTGGTGGCCCAGGGGGGCAATCATGGC
GCGCTGTCGATCGATCCGGGCTTCCTCAGCAGCCTGAACAGGCTGACGCAGATCTCGAGCGTGCTGTTTC
CCTCGGGCGACGCGCATGTGCGCTTCGAGCTGCAGGCGGTGCCGTTCTCGGGGATTACTGAGATGAAGTT
CGTGCTGTCCGGACGTGAGCTGCATTACTTCAACCAGAAGCAGGAATGGATGCCGTTCGAATGGCCCGGC
CAGTCGCTGGAGAATCTGTCGCACATCGAATGGCAGACGGAGCAGGGTGGGCTGCGCACGGCGCTTGATG
CACAGGGACGGTTCGGGCTGATCCGGCTGCTGGAGCGCGCCAGGGTAATGCAGCAGGACAGCGCGCGCTT
TCTGCTGACGTGGAGCCCGGAGACGAGCGAAGGCATTGCGCTGAAGGTGCAGCTGCGCAGCGAGGCCGGC
GCAGGTCCGCTGGACGTGTTGCAGCTGCGTCATTTCATGTTGCCGACGCGGGTCTTCGTCACCGGTGCGG
CGAATGGGGCGGTGAATGGGGCGGTGAATGGCGTGCCAAAGCGCCTGGCCACGGCTTTGCCAGCGCAGCC
ACCGCCGCTGCCGCCTGCTGCGATGGCGGCAGCGAGGCACGCCGGGACGCCGTTGCCATACGGCGCGTTG
CCGGAGGTGGAATGA
 Primer design