SecReT6
Protein ID: 407932345
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1665
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1760737..1761240 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0HBT5
KEGG IDabh:M3Q_1665
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|407932345|ref|YP_006847988.1| hypothetical protein M3Q_1665 [Acinetobacter baumannii TYTH-1]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1760737-1761240 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCTCGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCAGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCCGAGG
CCGATCATGAATAA
 Primer design