SecReT6
Protein ID: 407932346
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1666
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1761233..1762714 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0H5B2
KEGG IDabh:M3Q_1666
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.60E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|407932346|ref|YP_006847989.1| hypothetical protein M3Q_1666 [Acinetobacter baumannii TYTH-1]
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1761233-1762714 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATCTTTTAGATTCGATTG
TTGAACAAAGCCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTTAATTGGTGAGCTTGC
TAAAGAAGTAATGGCAGGGACCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATTGATGCTCTGATTTCAAAGCAGTTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGT
CAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCCTTCAAATCCGCTCATTAAAATTCGTATGCT
TAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACTTTGATCAAAGCACTTTGTTT
AAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATTGGTGATTTTG
AGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGCAGCGGCAGCACATGC
ACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCAC
GTTATGTTGCATTGACTTTGCCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGAC
AGAAGGCTTTAATTTTATTGAAGATGTTTCTGGTGAAAACCACAATGAATATTTGTGGATGAATGCAGCT
TATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCTATTCGCGGTGTTG
AAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAAGATGGCGAAGTGGTATTCAA
GTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGCTTCATTCCGTTA
GTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTAT
TGCACATTACTTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCGTTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTTTCTTTACGACTTGTCACTGAGTTACCTCAG
TCCTCAAATTAA
 Primer design