SecReT6
Protein ID: 407932347
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1667
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1762764..1763267 [+]
Producthypothetical protein
NoteTssD
UniProt IDK0HDC7
KEGG IDabh:M3Q_1667
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|407932347|ref|YP_006847990.1| hypothetical protein M3Q_1667 [Acinetobacter baumannii TYTH-1]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1762764-1763267 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA
 Primer design