SecReT6
Protein ID: 407932349
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1669
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1764074..1765651 [+]
Producthypothetical protein
NoteTssF
UniProt IDK0HM76
KEGG IDabh:M3Q_1669
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.10E-124, Aligned region: 2..525
Protein Sequence: 525 a.a.     [Download]
>gi|407932349|ref|YP_006847992.1| hypothetical protein M3Q_1669 [Acinetobacter baumannii TYTH-1]
MFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQEVKLLPIHLSGLDFKT
TPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELS
KNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELLIHFKLNLN
DQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKT
NQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFISTKLLCSNRD
LPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDAVSHVKELL
ALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFSQLLSRVFN
LKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1578 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1764074-1765651 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGTTCCCTCAATACTTACGGCATTTTCCTGCGTGTTCAGTTGTTAGCTTTGAAGATATTAATAAGATTA
AACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAAATCTCGTAGTTTCAAAGGAGTACA
GTGTGAGTTTAATACAACTCAAGAGGTTAAATTACTACCTATTCATTTAAGTGGTTTAGATTTTAAAACT
ACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCCTTAAATTTGAAATTTTTAATAATG
CTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGCTATCTCTAATTTTCCTCTACAGGT
CCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATATGGACAAACAATTGTAGAATTGAGC
AAGAATCCATTTGAATTGATTGGTTTTGCAGAACAAGAAAGTTTATTACCGCTTGATCAACATACCCATC
ATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTTTAGTTATCTTAAGCTCGATTTGGA
TTTTTTAAGGCGACTACCTCAGCATGTATCCGAATTTGAGCTTTTAATTCATTTCAAATTAAACTTAAAT
GATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACTTTAAATTATTTACTACCCCCGTAA
TTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCACAAGCAATTAGAATATCCTTTAGTTAC
AGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAGATGAATATGGTGCGTGAAAAAACA
AATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGAGCCATTACCACAATGATACAGCTC
GCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGTTGAAATGGGCTATTCGATTATTTC
TAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACTAAATTATTATGTTCAAACCGTGAT
TTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAAATGATAGTAGCTTGGCGAGACGTG
CCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGGCCAAAGTGAACAGTGGCGTGTGAT
CTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCTGTTTCTCATGTTAAAGAGCTGCTG
GCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAGAATCAATTAAAAAATTAGAATTTT
CTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGTAAGAGGAGTAAAAGCTGAATTACA
AATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGTCAGTTATTAAGTCGTGTTTTTAAT
TTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATTATTCATCTCAGCAGGAGTTATACC
AATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA
 Primer design