SecReT6
Protein ID: 407932354
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1674
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1772877..1773644 [+]
Productouter membrane lipoprotein
NoteTagL
UniProt IDK0HM83, K0HM83
KEGG IDabh:M3Q_1674
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 21..44
OmpA [PF00691], Evalue: 1.20E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0046, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|407932354|ref|YP_006847997.1| outer membrane lipoprotein [Acinetobacter baumannii TYTH-1]
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQSLVQPPYQLFSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKNIPADHLSTEGLGSSKPVADNTSAEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1772877-1773644 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGAATCAAAAATATCAAATTAAACTTTCACAACTTATAAAAGGCTGTTTTATATATGCAATTGCGAATT
ATGCTTTAGCACAGCCTATAGTTGTAGAAGGTGTAGTGCCAAATGAAGCAAGTAAACAGGCTATTTTAAT
GAAAATGCAGTCTGTTTATGGTGCAGATCAGGTTGTCGATAAAATACAAGTTCGACCAGTTGCCGCTCCA
AATGGATGGAGTGACTCTGTCACACGAGTGATTACACCTGATCTTAAAAAAGTTTCTCAGGGTAAGTTAA
GTGTTAATGGAACCCGATTTGAACTGACCGGGAAAATGCTAAATCCGACAGAAATACAGCCAACCATTCA
GTCTTTTCAGAGTTTGGTACAGCCTCCATATCAATTATTTTCCCAGCTTTCTGTAAATCAGGCTGAGCAG
AAGATTATTGATGATGCTTTAAAAAATCGAATTATTGAATTTGAATCTGGTAGTGCAGTATTAACTGAAG
CTGGGCAAAAAATTCTTGATGAAATGGCTGTGGCTTTAAATAAAGTGGGCGGGAAAAAAGTCAAAATTGT
GGGGCATACCGATAGTTCTGGTGATGCGACCAAAAACTTAAAACTCAGCCAAGATCGAGCTTTAGCAGTT
AAAAATTATTTAATTAGTAAGAATATTCCTGCTGATCATTTATCTACCGAAGGTTTAGGTTCATCTAAGC
CTGTAGCGGACAATACTTCTGCGGAAGGTAGGAAGAAAAACCGCCGAATTGAGTTCACCGTTTTATAG
 Primer design