SecReT6
Protein ID: 407932356
SecReT6 ID708
T6SS typei4b
Gene symbol-
Locus tagM3Q_1676
StrainAcinetobacter baumannii TYTH-1
Repliconchromosome [GenBank: NC_018706] [Browse all T6SS(s) in this replicon]
Location [Strand]1774147..1776825 [+]
Productchaperone ATPase
NoteTssH
UniProt IDK0H5B9
KEGG IDabh:M3Q_1676
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 228..306
AAA_2 [PF07724], Evalue: 1.10E-43, Aligned region: 605..773
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 229..342
AAA [PF00004], Evalue: 1.40E-23, Aligned region: 610..728
AAA_5 [PF07728], Evalue: 5.90E-14, Aligned region: 229..251
AAA_5 [PF07728], Evalue: 5.90E-14, Aligned region: 609..730
ClpB_D2-small [PF10431], Evalue: 4.90E-13, Aligned region: 383..396
ClpB_D2-small [PF10431], Evalue: 4.90E-13, Aligned region: 779..849
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 9..72
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 206..251
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 273..308
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 473..515
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 604..653
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 675..703
AAA_22 [PF13401], Evalue: 5.70E-09, Aligned region: 228..322
AAA_22 [PF13401], Evalue: 5.70E-09, Aligned region: 453..502
AAA_22 [PF13401], Evalue: 5.70E-09, Aligned region: 606..636
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 226..247
Sigma54_activat [PF00158], Evalue: 8.80E-08, Aligned region: 606..716
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 229..249
AAA_19 [PF13245], Evalue: 1.10E-07, Aligned region: 605..631
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 229..301
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 605..636
AAA_25 [PF13481], Evalue: 2.40E-07, Aligned region: 832..864
AAA_14 [PF13173], Evalue: 4.60E-07, Aligned region: 229..332
AAA_14 [PF13173], Evalue: 4.60E-07, Aligned region: 607..692
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 229..276
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 608..646
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 223..289
IstB_IS21 [PF01695], Evalue: 1.50E-06, Aligned region: 609..629
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 229..327
NACHT [PF05729], Evalue: 4.00E-06, Aligned region: 609..648
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 229..259
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 487..541
AAA_18 [PF13238], Evalue: 8.10E-06, Aligned region: 610..639
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 62..105
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 208..242
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 281..378
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 471..488
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 605..655
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 229..249
Zeta_toxin [PF06414], Evalue: 1.90E-05, Aligned region: 604..649
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 228..247
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 299..309
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 573..631
RuvB_N [PF05496], Evalue: 0.00014, Aligned region: 678..704
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 604..633
AAA_29 [PF13555], Evalue: 0.00033, Aligned region: 713..733
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 230..253
RNA_helicase [PF00910], Evalue: 0.00092, Aligned region: 610..631
T2SE [PF00437], Evalue: 0.001, Aligned region: 214..248
T2SE [PF00437], Evalue: 0.001, Aligned region: 422..457
T2SE [PF00437], Evalue: 0.001, Aligned region: 581..678
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 229..266
AAA_28 [PF13521], Evalue: 0.0016, Aligned region: 609..632
Atg14 [PF10186], Evalue: 0.0035, Aligned region: 437..519
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 224..249
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 588..632
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 230..301
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 608..630
TIP49 [PF06068], Evalue: 0.0041, Aligned region: 229..252
TIP49 [PF06068], Evalue: 0.0041, Aligned region: 277..309
TIP49 [PF06068], Evalue: 0.0041, Aligned region: 609..644
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 229..249
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 280..305
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 609..630
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 229..331
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 384..506
DUF2075 [PF09848], Evalue: 0.0063, Aligned region: 608..640
MobB [PF03205], Evalue: 0.0064, Aligned region: 230..263
MobB [PF03205], Evalue: 0.0064, Aligned region: 608..639
Clp_N [PF02861], Evalue: 0.0078, Aligned region: 31..73
Clp_N [PF02861], Evalue: 0.0078, Aligned region: 101..131
Protein Sequence: 892 a.a.     [Download]
>gi|407932356|ref|YP_006847999.1| chaperone ATPase [Acinetobacter baumannii TYTH-1]
MSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADALADDL
KETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLFP
IDSMKHKFLEICEKSVEQQEESKTSSQADELEQAVTPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGRE
YEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKGE
FENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYFE
KDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSVL
DTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKSQLESLQSEIQETQEQW
QKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKMV
NDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANEL
YGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFYQ
VFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLGR
MRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTVL
PALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|407930685|ref|NC_018706.1|:1774147-1776825 Acinetobacter baumannii TYTH-1 chromosome, complete genome
ATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTGCTA
ATGCTTGTGTTCTTCAGCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCAGCC
TTTAGAAAACGATTTAAAAATTTTATTAAAAAAATATAAAATCTCAGCCGATGCTTTAGCAGATGATTTA
AAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAATCAATTGTTCGTT
TATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACTGGT
TGCATTATTAACTGCACCTGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTCGATCTTTTCCCG
ATAGACTCAATGAAACATAAGTTTCTCGAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAAAAA
CATCTTCACAAGCAGATGAATTAGAACAAGCCGTGACTCCAACTGCAAAAACTCAAAAAACACCTGCTTT
AGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCGTGAA
TATGAAATTCGTTTGATGCTCGATATTTTAATGCGTAGACGTCAGAACAACCCAATTTTAACTGGTGAGC
CAGGTGTAGGTAAAACAGCTGTAGTTGAAGGGTTGGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGAGGC
ATTAAAAAATGTACATTTGCATGTTTTAGATATGGGGCTTTTGCAAGCTGGGGCAAGTGTTAAAGGTGAA
TTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATTATTTTATTTATTG
ATGAAGCACATACGCTTATTGGAGCTGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAAACC
TGCACTTGCACGTGGCGAGTTACGTACTATTGCTGCAACGACATGGGCAGAATATAAACAGTATTTTGAG
AAAGATGCTGCATTGAGCCGCCGTTTTCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTGTAG
ATATGTTACGTGCAATGATTCCTGTAATGCAAAAGCACTTTAATTTACAAATTGATGATGAAGCAATTGT
AACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAACTCCCAGACAAAGCAGTAAGTGTTCTT
GATACTGCGGCAGCGCGTGTAGCTTTGACCCAAAATGCACAGCCAGTCAAACTTGATCAATTAAAAGCAC
AAGAACATAACTTAAAGCTTGAGCAACAGATTTTGGAAAATGAACACCGTCAGATTCCAATACATCATGA
AAGATTAGAAAATCTGAAAAGCCAACTAGAGTCATTACAAAGTGAGATCCAAGAGACTCAGGAACAATGG
CAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCTAATGAGTCTGAAG
CCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTTTGA
GCGAGTAAACTCTCAGATCATCAATGAAATTATTTCTGATTGGACTGGTATTCCTGTTGGGAAAATGGTC
AATGATGAAATTAAGCAGATTTTAACGCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATTATG
CACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTAGAAGATCCAAATAAACCTCAAGG
GGTGTTCCTTTTAGTTGGACCTAGTGGGGTTGGTAAAACCGAAACTGCTTTAGCCTTGGCTAATGAGTTA
TATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTTCGC
TTAAAGGTGCTCCTCCAGGCTATGTGGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGTCGTAA
TCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAAGCACATAGCGATGTTCAGGAGTTGTTCTATCAA
GTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGATTTTAAAAACACGACAATCTTAT
TAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCCTAC
CGCGGAAGATTTAATCGAACATTTAAAACCGAGTTTATATAAACAGTTTAAGCCAGCCTTCTTAGGGCGT
ATGAGAGTTGTGCCATATTTCCCATTGCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGGGCA
AAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATATTCAGATGACTTGGTCGAGTTGCT
ACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTTTTA
CCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGATCATGATTGATG
CAAAAGATGACGAGATCCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACGGACTAGTAAAAA
GTTGAAATCAGAAGTTTAA
 Primer design