SecReT6
Protein ID: 409248686
SecReT6 ID767
T6SS typei3
Gene symbolsafA
Locus tagSENTW_0226
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]10058..11113 [-]
Productputative cytoplasmic protein
NoteTssA
UniProt IDE8ZXV7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 1.50E-18, Aligned region: 224..241
Protein Sequence: 351 a.a.     [Download]
>gi|409248686|ref|YP_006884526.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAALLDHEG
VMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQ
VWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGI
SLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDAL
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|409248675|ref|NT_187073.1|:c11113-10058 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AGTACCTGCTGCTGTTCAGTCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACGC
AACTGGCAGAACTGAGCGTAATCTGGTCCGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGC
GTGATGGCAGACATTCGCGGTATCACGCTGTCAAACAGCGCCGCCCTGCGCCTGCAGGTACGGGATGTCG
AGCGCGCGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGA
CCTCGAAGCCCGTGGGGCATTACCGCTGGCAGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAA
GTGTGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGC
TGCCTGACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGG
CACGGTTATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATA
TCCCTCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGTA
TTCGTCGCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACT
GGTGGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTG
GAGTGA
 Primer design