SecReT6
Protein ID: 409248690
SecReT6 ID767
T6SS typei3
Gene symbolsat1
Locus tagSENTW_0230
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]14506..15345 [-]
Producthypothetical protein
NoteTagJ
UniProt IDE8ZXW1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.10E-45, Aligned region: 148..271
Protein Sequence: 279 a.a.     [Download]
>gi|409248690|ref|YP_006884530.1| hypothetical protein SENTW_0230 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MEIPPMKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCA
RMEANYTQEARLYRELVRCEMFRRTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAI
TDTGGQWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLINGDT
HGAWLFTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 840 bp     [Download]
>gi|409248675|ref|NT_187073.1|:c15345-14506 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGAAATACCGCCCATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGATACAGGAATACT
CTATTGCGGAGGGGATTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCA
CAGCCTGTTTCAGTTGCTGTGTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCC
AGGATGGAGGCCAATTATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCC
GCACCGTTTTTCAGGGTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCT
GGCGGCACTCGCCTGTCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATA
ACAGACACGGGCGGGCAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCC
CAGTACTTGAGCTGGTCACCGGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATC
GCCGCAACCGACGCGCCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGATAAATGGCGATACG
CACGGCGCCTGGCTCTTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGG
AAACCGCCTGGCAGGATGGCCCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGCTGACCAG
CCACGGCGATATCAGCCTGCTGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA
 Primer design