SecReT6
Protein ID: 409248693
SecReT6 ID767
T6SS typei3
Gene symbol-
Locus tagSENTW_0233
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]19326..19868 [+]
Producthypothetical protein
NoteTssB
UniProt IDE8ZXW4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|409248693|ref|YP_006884533.1| hypothetical protein SENTW_0233 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|409248675|ref|NT_187073.1|:19326-19868 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACCCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA
 Primer design