SecReT6
Protein ID: 409248702
SecReT6 ID767
T6SS typei3
Gene symbol-
Locus tagSENTW_0242
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]24825..25361 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE8ZXX3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|409248702|ref|YP_006884542.1| hypothetical protein SENTW_0242 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MNKWRNPTRRLCAVAMPFVLLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFVPGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|409248675|ref|NT_187073.1|:24825-25361 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
GTGAATAAATGGCGTAACCCCACTCGGCGGTTATGTGCGGTAGCTATGCCTTTTGTACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATTCGTGTTTATGAACTAAAAAAT
GACGCCGCTTTCACGACAGCCGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCGTACCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA
 Primer design