SecReT6
Protein ID: 409248703
SecReT6 ID767
T6SS typei3
Gene symbolsciO
Locus tagSENTW_0243
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]25365..26708 [+]
Producthypothetical protein
NoteTssK
UniProt IDE8ZXX4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|409248703|ref|YP_006884543.1| hypothetical protein SENTW_0243 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MSWNDCVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|409248675|ref|NT_187073.1|:25365-26708 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGAGCTGGAATGACTGCGTAGTCTGGAGTGAAGGACAGTTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACACGTCATGCATTACCGCAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTCCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCGCTGACCATCCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTACGCGCGCCGAACAGCGAAGAAACCACGTTTGACAATAA
CCCGGAATCACTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCACCTGCGCCTGCGGCTGCTGCCGGAAAAAGCGGTGACGGGCGCCTGGA
TTGGCCTGCCGTTGACCCGCATCACCGGGTTGAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCACTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGGATGCGGGCCGATTCGCTGGCGGAACGGCTGACAGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGTTGCAAATTCTCAATCGCTTTGAGCCGCTGTTGACCCACCTGGCGAAAACCCC
GCTGGCCCCGGAAGTGTTGTATCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACCTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCGCTGG
TTGATGAGGTGCAGTTCCTGCTGAATGCGGTACTGATCCGGGGCGCGCAGCGCATCGAACTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCTCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA
 Primer design