SecReT6
Protein ID: 409248707
SecReT6 ID767
T6SS typei3
Gene symbolsciS
Locus tagSENTW_0247
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]29455..33324 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8ZXX8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-92, Aligned region: 588..916
ImcF-related_N [PF14331], Evalue: 2.90E-92, Aligned region: 263..541
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 446..482
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1025..1146
Protein Sequence: 1289 a.a.     [Download]
>gi|409248707|ref|YP_006884547.1| hypothetical protein SENTW_0247 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEVSAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRT
LTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASL
PHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDY
LNEISARATRLDGDVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLY
NRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDS
VAGFGGRAAVLTHIEALFDGSRVVHSPYEKNEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLV
RAVGADAGTVFVRSNGAPLDRGVPGIFTHEGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAV
VEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQ
SGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKI
NAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDP
WRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAH
GPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGKVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3870 bp     [Download]
>gi|409248675|ref|NT_187073.1|:29455-33324 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCGGTTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCACTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGTAGCCG
GGTAGTGACCATTGCCCTGTTACTGATGCTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCACCGCTGTGGGTCCGCCTGACATTAATTGGTTTCATCCTGCTGATGTACGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCAGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AGCTGCGGCAGTTGCGGGTGGATATGCCTGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGCGACGGCAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACCTCGCGTATCCTGACAGTACCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCGGTGTTGATTGACACCGCCGGACGCTACGCCCGCCACGATGA
CGGCGGAGAAGTGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGGTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGGCGGCCTGCGCCGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGAT
TCGCTTTCCGGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAGTATTTTCGCACG
CTGACCAGCCATCTTCGCGCACAAATCTGGGGCTTCACGTTGCCGTACAGCCGCAGGCGAAAAGCGGGCG
ACCCGCAGGCGCTGCACGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTACGGCTGGATCAGGGACT
GGATACCCGGTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTC
GCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGC
AACTGAATAACACGCTGCGCGGGGTGTTTTTCACCAGCGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGA
CCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCCTCCGCCTCTCTC
CCGCACGCTCTGCCGGACGGCAACCGCAGCTACTTCCTGCATGACCTGCTGACACAGTTTATTTTCCGTG
AAGCGCACCTGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCT
GCTGGTACTGGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTAT
CTGAATGAAATCAGCGCCCGCGCGACCCGGCTGGACGGTGATGTGAAAGCCTACACCGGTAAACCGGCGA
TGGCTCCCGTCCCGGCACTGCTGGACAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGC
GCCGCCGCTGACCTGGCGCTACGGCCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTAC
AACCGCCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCA
TTGCCCGTCAGGACAGTAAAGCGGCCTACGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGA
TCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGC
GTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGG
TGCATTCACCGTATGAGAAAAATGAGGCGCTGATCCGTCAGGCGCGGGCATTCCTCGACGGTCACACCAG
TACCGAGCGTATCTATGCGCGGGCGCTGGCGGCAATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTA
CGCGCCGTCGGCGCGGATGCGGGAACGGTGTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGC
CGGGTATTTTTACCCATGAAGGATACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGC
GACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGC
CAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAATATGCCCGCC
GCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGC
CTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTG
GTGGAGCAGACCACGCTGGTGCCGCCGCCGGATCCGCAGGCCAGACAGAAACAGCTGGCGCAGCGCGCGT
CCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGA
AAAAACGCTGGTGGATGATCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAG
AGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCA
TTGCTGATAGTGCGCTGGCGGCAGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGA
GGCGGCGAAACTGCCCGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATC
AACGCCGGGACCGGCGATGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCA
TCGACGGGCGCTATCCGTTCGCCGACAGCCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGC
CAGCGGCGGCGTACTGGATGCCTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCG
TGGCGCTACAAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATCTGACGCCGTTTCAGCAGGCGA
AGCAGATCCGCAGCGTGTTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGT
GGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGTCAGGTGCTGCGCTACGCCCAT
GGTCCGGACCGGCCCCTGAAAGTGACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCA
GCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGA
CGCCGGAAAGGTGCAGGAAACGGCGGTGCGGGGGCGACAACTGGTGGAATATGATTTTGACGGTCGCCGG
GTGGTGCTGGAAATCACCGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTT
GCCCGGCGAGGGCGTTGTAA
 Primer design