SecReT6
Protein ID: 409248713
SecReT6 ID767
T6SS typei3
Gene symbolrhsG
Locus tagSENTW_0253
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]37404..39605 [+]
ProductRhs-family protein
NoteTssI
UniProt IDE8ZXY4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-79, Aligned region: 125..433
Phage_base_V [PF04717], Evalue: 2.30E-26, Aligned region: 471..563
Phage_base_V [PF04717], Evalue: 2.30E-26, Aligned region: 667..689
Protein Sequence: 733 a.a.     [Download]
>gi|409248713|ref|YP_006884553.1| Rhs-family protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MSFVSTGNKTVGSDGPAITTPPIVGENNGVSSGAAVASVTDAAEQMAEQAVELLFGELPEPSGLVKAAVA
AAQAAAVAAGISDIAGAAQDVMSSLISGPGVHNVTVSGSAVPPQMLLFASLNGSETLGALFTYVVQLKTP
DTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTH
TSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSED
SHTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVAN
PRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQE
YLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQY
GRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTM
PPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIK
NETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHT
SDVMQLIGKGIDMNPDGGTAVTADDIAPLPTSE
 
Nucleotide Sequence: 2202 bp     [Download]
>gi|409248675|ref|NT_187073.1|:37404-39605 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGAGTTTTGTATCCACGGGTAATAAAACTGTCGGGAGCGATGGGCCAGCTATCACTACGCCGCCAATTG
TCGGAGAAAATAACGGTGTTAGTTCAGGTGCCGCCGTAGCCAGCGTTACTGACGCAGCCGAACAAATGGC
AGAACAGGCAGTGGAATTGTTGTTTGGCGAGTTGCCGGAACCATCAGGACTGGTAAAAGCCGCGGTGGCA
GCGGCGCAGGCCGCCGCTGTGGCGGCAGGGATATCGGATATAGCTGGTGCCGCACAGGACGTAATGTCAT
CCCTTATCTCCGGACCGGGAGTGCATAACGTTACGGTAAGCGGCAGTGCCGTGCCGCCGCAGATGTTGTT
GTTTGCCAGCCTTAATGGCTCGGAAACACTGGGAGCCTTGTTTACTTATGTGGTACAGCTAAAAACGCCC
GACACCCTGAATCTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATC
TGTGCGTCAACATCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGT
GGTGGGCCATGAAGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGCTGAAACTGCTGACCCAC
ACCAGCGACTACAAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATC
CCTACCCGGTGGAAAAGCGACTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAAC
TGATTTTGATTTTCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAACACAGCGAGGAC
AGCCACACGCTGGTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGT
GGCACCAGGAAGGGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGAC
TGGCCAGTGGGTGCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACGGTGGCAAAC
CCGCGTGAAACCGGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAG
GCGAGATGCTGACGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAA
TATCCGCACACTCATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACCGCCGAAGTCAATCAGGAA
TACCTGCTGATGCAGACCTTGCTGTTTGTACAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTA
CCTTTTCCACCCGTTTTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACC
CCACACCAAAGGGCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGGCAGGAAATCTGGACGGATCAGTAC
GGGCGGGTAAAGGTACAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATAC
GCGTCAGCTACCCATGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCT
GGTGGATTTCAAAAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGCACCTACAACCAGGACACCATG
CCGCCGTGGGGACTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAA
CGAACGGCAACATGCTGCGTTTTGATGATAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGA
TCTCAACACCACGGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAA
AATGAAACCAACAGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAAC
TGGCGCAGACGATCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGG
CAATGCGGCGCTTGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACC
AGCGATGTCATGCAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCG
ATGATATTGCCCCCCTTCCCACCTCTGAGTGA
 Primer design