SecReT6
Protein ID: 409248715
SecReT6 ID767
T6SS typei3
Gene symbolrhsD1
Locus tagSENTW_0255
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]40094..44182 [+]
ProductProtein rhsA
NotePAAR
UniProt IDE8ZXY6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 390..425
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 485..485
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 624..660
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 666..696
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 708..744
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 751..785
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 797..826
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 848..883
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 889..920
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 981..998
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 989..1017
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 1033..1051
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 1056..1089
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 1119..1126
RHS_repeat [PF05593], Evalue: 9.30E-49, Aligned region: 1144..1165
PAAR_motif [PF05488], Evalue: 2.90E-15, Aligned region: 71..140
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 654..662
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 866..884
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1040..1050
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1145..1177
Protein Sequence: 1362 a.a.     [Download]
>gi|409248715|ref|YP_006884555.1| Protein rhsA [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVICSRFYASHLETVGLLGRGWRLNWETSLRED
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNAAGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTIVTGRQG
ESWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQM
TRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRRIT
GSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVTALTNSNGAQYRFSHDADGRLVREVRPDGLSRTFI
LDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQ
ADTVRFEYDRSGWLTAEHAGNGSIRYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYER
DSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLAPGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDG
LRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGPVMNNRLPGCGRDRYGYNEWGELTTRR
DQQLEWNAQGQLTRVISGNTETHYGYDALGRRIRKATYGRHTGHTARSRTDFVWEGVRLLQENVQQQGWR
TYLYDAEQPYTPVASVTGRGENRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFH
QPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGINLYQYAPNPLSWIDPWGLTGTYIFTDG
TTYYIGKGPESRMYDSMDYRIGGRANAIQFAHMDFGDDKLGFMVEHRLMEKYNARYSPDFANSERISSPG
KILYDAADAKTQRKVNRLANKLDSKYRASKGC
 
Nucleotide Sequence: 4089 bp     [Download]
>gi|409248675|ref|NT_187073.1|:40094-44182 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGTATGAAGCAGCCCGTGTGGATGACCCTATCTACCACACCAGTGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAGGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACTCTGCCCGGTCGCCTGCCGGTCATCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGTTGAACTGGGAAACCAGCCTGCGCGAGGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGGCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGG
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGTGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCATCGTCACCGGCAGGCAGGGG
GAGTCATGGCAGTGGTGGTACGACAGGGAGACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGGCAGATG
ACGCGGTACACCGACTGTTCAGGGCGCAGCACAGGATATGACCACGATGAGGACGGCAACCTGACGCGGG
TGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGTAAACTC
ACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGCATCACG
GGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGAAGCGCG
AGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGACCGCGCTGACCAACAGCAACGGGGCGCAGTACCG
GTTCAGTCACGATGCGGACGGCAGGCTGGTGCGTGAGGTGCGCCCGGACGGACTGAGCCGTACTTTTATC
CTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGCACGCAGGGCGGCGTGCGGCGGGAGACGC
AGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAA
CCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAG
GCCGACACGGTGCGTTTTGAGTATGACCGTAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGCAGCA
TACGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCA
TCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGC
GACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACG
GGCTGCTGAGCTGGCAGCGCAGCCTGGCGCCCGGCAGTGCCCCTGTTCTTCCCGGCCAGCGCCCGGCGCG
GCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGC
CTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATG
ACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGTCCGGTGATGAA
CAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGTTATAACGAGTGGGGCGAGCTGACCACGCGGCGC
GACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACT
ACGGCTACGATGCGCTGGGGAGGCGAATCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCG
GAGCCGGACGGACTTTGTGTGGGAGGGGGTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGG
ACATATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAACAGGC
AGGTGTGGTATTACCACACGGACGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGT
GTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCAC
CAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATT
ATGCACCGGAGTGTGGCAGGTTCGTCAGTCAGGATCCGATTGGGCTAAGGGGCGGGATAAACCTTTATCA
GTATGCGCCGAATCCGTTAAGTTGGATCGATCCATGGGGATTGACAGGGACATATATTTTCACTGACGGT
ACTACATATTATATTGGCAAAGGGCCTGAATCCAGAATGTATGATTCGATGGACTATCGTATAGGTGGTA
GGGCTAATGCGATACAATTTGCGCATATGGATTTTGGTGATGATAAATTAGGTTTTATGGTCGAGCATCG
TTTAATGGAAAAATATAATGCTCGGTATTCTCCTGATTTCGCGAATAGCGAACGTATAAGCTCACCTGGT
AAGATATTATATGATGCTGCCGATGCTAAGACACAAAGAAAAGTTAATCGATTAGCTAATAAATTAGATA
GTAAATATAGAGCATCTAAGGGTTGTTAA
 Primer design