SecReT6
Protein ID: 409249528
SecReT6 ID768
T6SS typei1
Gene symbolpmt1
Locus tagSENTW_1059
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]52891..56400 [-]
Producthypothetical protein
NoteTssM
UniProt IDE9A084
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.60E-82, Aligned region: 500..813
ImcF-related_N [PF14331], Evalue: 3.80E-60, Aligned region: 201..447
DUF1215 [PF06744], Evalue: 2.00E-33, Aligned region: 909..1028
AAA_22 [PF13401], Evalue: 0.00066, Aligned region: 136..268
AAA_22 [PF13401], Evalue: 0.00066, Aligned region: 656..678
AAA_22 [PF13401], Evalue: 0.00066, Aligned region: 847..882
Protein Sequence: 1169 a.a.     [Download]
>gi|409249528|ref|YP_006885353.1| hypothetical protein SENTW_1059 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MFRLPTPRLFSTLRSAMPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAAWGLI
ALAWLTVRVMKRLQLLEKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYMVIGP
AGSGKTTLLREGYPSDIIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDADILHRRLWTHMLDW
LAQKRARQPLNGLILTLDLPDLLTADKPRREHLLQILRGRLQDIRQHLHCQLPVYVVLTRLDLLHGFAAL
FQSLDRNDRDAILGVTFTRHAHENDDWRTELNAFWQAWGERLSNALPERMLAPGSRSSLFSFVRQIQGGR
EPLIALLNGLLDGENMDVMLRGVYLTSSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLF
PQTLLAEPNLASESRVWLMQSRRRLSVFSATGGIAALLLIIGWHHYYTDNWQSGITVLEQAKAFMSVPPP
QGMDEYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPALFNGLVK
EMNAAPAESEEKLAVLRVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLMSHLDYALKHTDWHA
ERQAGDGDAISRWTPYDSPVVAAQKELSKLPVYQRVYQSLKTRAMGVLPADLNLRDQVGATFDQVFTSGD
DNKLIVPQFLTRYGLQSYFVKQRDALIELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWR
AGMDNLNVRNYESIAQLTGALEQIISGDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTR
LGHEFAPENSTLAIQKDKENTLQAVYQQLTELHRYLLAIQNALVPGKSALKAVQLRLDQNSSDPIFATRQ
MAKTLPAPLNRWVGKLADQAWHVVMVEAVHYMEIDWRDNVVKPFNEQLANNYPFNPRSSQDASLDAFERF
FKPDGVLDTFYQQNLRLFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQNGLGAQFAVETVSL
SGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSISFSGPWAQFRLFGAG
QLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3510 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c56400-52891 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
GTGTTCAGATTACCGACACCCCGATTATTCAGCACACTGAGATCGGCAATGCCCCGGTTTAAGGTTTCTG
CCGCCTGGCTGCTGGCGCTGGCGTGGATTTTGCTGCTGGTATGGATCTGGTGGAAAGGTCCGTCATGGAC
GCTCTACGAGCAGCGCTGGCTGGCCCCGCTGGCGAACCGCTGGCTGGCCACCGCCGCCTGGGGGTTGATT
GCGCTGGCGTGGCTGACCGTCCGGGTCATGAAGCGCCTGCAACTGCTGGAAAAACAGCAGCGCCAGCAAC
GGGACGAGGCGCAGGATCCGCTCAGCGTGGAACTGAACACCCAGCAACGCTATCTCGATCACTGGTTACT
GCGTCTGCAACGCCATCTCGACAGCCGCCGCTATCTGTGGCAGCTACCGTGGTATATGGTCATTGGCCCG
GCAGGAAGCGGTAAAACCACGCTGTTGCGCGAAGGGTATCCGTCCGACATCATTTATGCCCCGGAGGCGC
TGCGGGGCGTGGAGCAGCGCCGGTATGTTATCCCGCATGTGGGAAAACAGGCGGTGATTTTTGACGCCGA
CGGTCTCCTCTTTGAGCAACAGGATGCGGATATACTGCATCGCCGCCTGTGGACCCATATGCTGGACTGG
CTGGCGCAAAAACGCGCCCGGCAGCCGCTGAACGGTCTGATACTGACGCTGGATCTGCCCGATCTGCTGA
CCGCCGACAAGCCACGCCGTGAGCACCTGTTGCAGATCCTGCGCGGACGTTTGCAGGATATACGCCAGCA
TCTTCACTGCCAGCTCCCCGTCTATGTGGTGCTGACCCGGCTGGATCTACTGCACGGTTTCGCCGCCCTG
TTTCAGTCACTGGACCGCAACGATCGCGACGCCATTCTTGGCGTCACCTTTACCCGTCATGCCCATGAAA
ATGACGACTGGCGTACAGAACTGAATGCCTTCTGGCAGGCATGGGGCGAACGGTTGAGTAACGCCCTGCC
GGAGCGGATGTTAGCCCCCGGCTCCCGCAGCTCTCTGTTCAGCTTTGTCCGCCAGATCCAGGGGGGGCGC
GAGCCGCTGATCGCCCTGCTGAACGGGCTGCTGGACGGGGAAAATATGGATGTGATGCTGCGCGGCGTGT
ACCTCACCTCCTCCCTGCAACGCGGCCAGATAGACGATATTTTTATGCAGTCCGCCGCCCGTCAGTTCCG
GCTGGGCAGCAGTCCGCTGACCGCCTGGCCGCTGGTGGACACGTTACCGTATTTCACCCGTAATCTGTTT
CCGCAGACCTTACTGGCTGAGCCGAACCTCGCCAGTGAAAGCCGCGTCTGGCTGATGCAGTCCCGCCGCC
GGTTGTCCGTGTTTTCCGCCACCGGCGGCATCGCCGCGCTGCTGCTGATTATCGGCTGGCATCACTATTA
CACTGACAACTGGCAGTCCGGCATTACGGTACTGGAGCAGGCAAAAGCCTTTATGTCCGTACCGCCGCCG
CAGGGAATGGACGAATATGGCAACCTGCAGCTGCCGTTACTTAACCCGGTGCGTGACGCCACGCTGGCCT
ACGGCGACTGGGGCGATCGCAGCCGCCTGGCCGATATGGGGCTGTATCAGGGCAGGCGTATCGGCCCGTA
TGTGGAGCAGACCTACCTGCAACTGCTGGAGCAGCGTTATCTTCCGGCGCTGTTTAACGGCCTGGTCAAA
GAGATGAATGCCGCGCCTGCGGAGAGCGAGGAGAAGCTCGCGGTATTGCGCGTTATCAGAATGCTGGAAG
ATAAAAGCGGGCGCAGCGACGAGGTGGTGAAGCAGTATATGGCGAAACGCTGGAGCGATAAATTTCACGG
CCAGCGCGATATTCAGGCACAACTGATGTCTCATCTGGACTACGCGCTGAAACACACCGACTGGCACGCG
GAGCGTCAGGCAGGCGACGGCGACGCCATCAGCCGCTGGACGCCGTATGACAGTCCGGTCGTGGCGGCGC
AGAAGGAACTCAGCAAACTGCCCGTCTACCAGCGCGTTTACCAGAGTCTGAAAACGCGGGCGATGGGCGT
GCTGCCCGCTGACCTGAATCTGCGCGACCAGGTGGGCGCCACGTTTGATCAGGTCTTTACCTCCGGGGAT
GATAATAAGCTCATTGTTCCGCAGTTCCTCACCCGTTACGGCCTGCAAAGTTATTTTGTCAAACAGCGCG
ACGCGCTGATCGAACTGACGGCGATGGATTCCTGGGTGCTGAACCTGACCCGCAGCGTGAAATACAGCGA
CGCCGACCGGGCGGAAATCCAGCGCCAGCTCACTGAACAGTATCTCAGCGACTACACCGCCACCTGGCGC
GCCGGAATGGACAACCTTAACGTGCGCAATTACGAATCCATTGCGCAACTGACCGGGGCGCTGGAGCAGA
TCATCAGCGGCGATCAGCCGCTCCAGCGGGCGCTGACGGCACTGCGCGACAACACGCAGCCTGCCGTTCT
CTCTGAAAAACTGGATGACAAGGCGCTTCAGGAGGCGATGGCGGAGCCGGATTACCAGTTGCTGACCCGC
CTGGGGCATGAATTTGCCCCGGAAAACAGCACGCTGGCGATACAGAAAGACAAAGAAAACACTCTCCAGG
CGGTCTATCAGCAACTGACGGAGCTGCACCGTTACCTGCTGGCTATTCAGAACGCGCTGGTGCCGGGAAA
ATCAGCGCTGAAAGCGGTGCAGCTACGGCTGGATCAGAACAGCAGCGATCCTATTTTCGCCACCCGCCAG
ATGGCGAAAACCCTGCCTGCCCCGCTCAACCGCTGGGTGGGCAAGCTGGCGGATCAGGCCTGGCACGTGG
TGATGGTGGAAGCGGTCCATTACATGGAGATTGACTGGCGTGACAACGTGGTGAAACCGTTTAACGAACA
GCTTGCCAACAACTATCCGTTTAACCCGCGCTCATCACAGGATGCGTCGCTGGATGCCTTTGAGCGATTC
TTTAAGCCGGATGGCGTGCTGGACACGTTCTACCAGCAGAACCTGCGTCTGTTTATGGAAAACGATCTGA
GTCTGGAGGACGGGGATAACAACGTGATTATTCGTGAGGATGTCCGGGAGCAACTGGATACCGCACAGGA
AATCCGCGAGGCGTTTTTCAGCAGACAGAACGGCCTGGGTGCGCAGTTTGCCGTGGAAACCGTGTCGCTT
TCCGGCAACAAACGGCGCAGCGTGCTGAACCTGGACGGGCAGTTAGTGGACTACAGCCAGGGCCGCAATT
ACACCGCCCATCTGGTCTGGCCGAACAACATGCGCGAGGGCAATGAAAGTAAGCTGACGCTGATAGGCGT
CAGTGGCGGCGCGCCGCGTAGCATCAGTTTCAGCGGACCGTGGGCGCAGTTCAGGCTGTTCGGCGCCGGG
CAACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTGGACGGCGGAGCGATGGTGTACC
GGGTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCAGTCAGTTCCGGCTGCCGGATAC
CCTGTACTGA
 Primer design