SecReT6
Protein ID: 409913608
SecReT6 ID603
T6SS typei1
Gene symboltssM
Locus tagKN400_3105
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3364678..3368142 [+]
Producttype VI secretion system ATPase and inner membrane protein TssM
NoteTssM
UniProt IDD7AEV8
KEGG IDgsk:KN400_3105
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.70E-63, Aligned region: 184..436
AAA_16 [PF13191], Evalue: 0.0006, Aligned region: 121..246
AAA_16 [PF13191], Evalue: 0.0006, Aligned region: 786..840
DUF1215 [PF06744], Evalue: 0.0015, Aligned region: 898..934
DUF1215 [PF06744], Evalue: 0.0015, Aligned region: 948..996
Protein Sequence: 1154 a.a.     [Download]
>gi|409913608|ref|YP_006892073.1| type VI secretion system ATPase and inner membrane protein TssM [Geobacter sulfurreducens KN400]
MSERMMKSLKWLLLASVVVLTVFLVAGIVLALDWPWWVTFCLLLLLAGIAAGAMLLRSLLLRRRERHFVR
EVIEQEKDTLSTLSDGSRTHLDQLAQQWKEGVGALRGSHLKRRGNPLYVLPWYLVIGESGSGKSTSLASA
RLPSPYTDSRRSADDAGTRNCDWWFFEESVVLDTAGRYAVPVNGERDRDEWQKLLALLVRHRRREPLNGL
VLTVAADRLLAGGREENAEEGRTMRRRVDELMRALGVRVPVYVLVTKCDLIEGMNCFAELLPEKALRQPM
GMINRDLTANVGSFTARTMETVTERLRSLRLQILHRPEARDATPALAFFPEEFAGLREGLTAFMEGTFRE
NPYQETPLLRGVFFASGRQAGSPRSRFSGTLGTVAGPQPLPDTSRGIFLHDFFARVLPADRALLTPTQRS
VQWRTVTGNLGLLSWLLVGLALCGLLSFSFVKNMATIREVSRQFERTPPINADPVNNLLVLESLRQGILR
VEEQNRAWWVPRFGLNESRRVEAVLKDKFCNQFRDGFLAPYDRHLAEELNGLSAATPDELFARYAIHLTR
RINILTASRAGRGLDELRALPQPASLSFMAAETPSVADAHKRFGELYLHYLAWRSDSPDLAREAAQLQGW
LRRSLALKTDSLSWLAPWVDRHGGLSPVTLAEFWGGSVPAPDEPTITPSFTGKGKDRIDGLMRELETAVG
DSRLLAKARAGFVPWYRALCLQAWQGFAASFPRGAERLRGSGEWQQAATRMATEHGPYFAFITRMTQELH
TLAGTEGLPPFAAQLFAFQIARTGGAVSHDAAANVTAESRRLMASIRRRLGNEAAASTIDPTFMASRSWQ
EYQAALAAIAPAASSRQQAFQLASQTFTDDPATGKTPFHAAWNAAARLKRDIAGAGADDAFWRLVTGPLD
FLWGYVRREAGCQLQTLWEEQVLAPTLGMPPQQAGPMLLGADGLAWRFVKGPAAPFVRGTAAGYAPRQAL
GGALPLEGSLFAFLGKGAQLNAMASGRQSNYTVAIKGLPTDANPEARIKPHGTRLELQCAGQAQALANHN
FPAGKTFYWSPDSCGDVIFQIEAGDQVLTKRYAGPQAFPDFLREFASGHRTFAAGEFPGEKDALARMGIT
SIRVSYQFTGSQQVIRQGGAMAGATAPRMIARCW
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3364678-3368142 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGAGCGAACGGATGATGAAATCGCTGAAATGGCTGCTGCTGGCGAGTGTCGTCGTGCTCACGGTATTCC
TGGTGGCCGGGATCGTCCTGGCGCTCGACTGGCCCTGGTGGGTGACCTTCTGCCTGTTGCTGCTCCTTGC
CGGAATCGCAGCGGGGGCCATGCTGCTGCGGTCCCTACTGCTGCGGCGCCGGGAGCGACACTTCGTCAGG
GAGGTTATCGAGCAGGAAAAAGACACCCTCTCCACCCTGTCAGACGGAAGCCGTACGCATCTGGACCAGC
TCGCTCAACAGTGGAAAGAAGGGGTGGGAGCCCTCAGAGGCTCGCACCTCAAGCGACGGGGCAACCCCCT
CTACGTGCTCCCCTGGTACCTGGTCATCGGCGAGAGCGGTTCCGGCAAGAGCACGAGCCTTGCCAGCGCC
CGTCTCCCCTCTCCCTACACCGATTCCCGACGGTCCGCCGATGATGCCGGTACGCGCAACTGCGACTGGT
GGTTCTTCGAAGAGTCCGTCGTGCTCGACACGGCGGGCCGTTACGCCGTGCCGGTCAACGGGGAGCGAGA
CCGGGACGAATGGCAGAAGCTCCTGGCGCTGCTGGTCAGGCACCGGAGACGCGAACCCCTGAACGGTCTC
GTCCTGACCGTGGCGGCAGACCGACTCCTTGCCGGCGGACGGGAGGAAAACGCCGAGGAGGGGCGTACCA
TGCGCCGCCGGGTGGATGAACTGATGCGCGCCCTGGGGGTGCGGGTACCGGTTTACGTGCTCGTAACCAA
GTGTGACCTTATCGAAGGGATGAACTGCTTCGCCGAACTTCTGCCGGAAAAGGCGCTGCGCCAGCCCATG
GGCATGATCAACCGAGATCTGACCGCCAACGTGGGCTCGTTCACGGCCAGGACCATGGAGACGGTAACCG
AGCGACTCAGAAGTCTCAGGCTCCAGATCCTCCACCGGCCCGAAGCCCGCGACGCGACGCCGGCTCTCGC
CTTTTTCCCCGAGGAATTCGCAGGGCTCCGCGAAGGGCTCACCGCGTTCATGGAAGGGACGTTCCGCGAA
AACCCCTATCAGGAAACCCCGTTGCTGCGAGGGGTGTTCTTCGCCAGCGGCCGTCAGGCCGGCAGCCCCC
GTTCCCGGTTCAGCGGGACACTGGGCACCGTTGCCGGGCCCCAACCGCTCCCCGACACCAGCCGTGGCAT
CTTCCTCCACGACTTCTTTGCCCGGGTCCTTCCCGCCGACCGGGCACTCCTGACCCCGACACAACGGTCT
GTCCAGTGGCGCACCGTCACCGGCAACCTCGGGCTCCTCTCCTGGCTGCTGGTGGGGCTGGCCCTGTGTG
GCCTCTTGTCGTTTTCCTTCGTGAAGAACATGGCCACCATTCGCGAGGTATCGCGCCAATTCGAACGGAC
GCCGCCCATCAATGCTGATCCGGTGAATAATCTCCTGGTCCTGGAGAGCCTTCGCCAGGGGATTCTGCGC
GTGGAAGAGCAGAATCGCGCCTGGTGGGTGCCCCGGTTCGGCCTTAATGAAAGCCGGCGGGTTGAAGCTG
TTCTCAAGGACAAGTTCTGCAACCAGTTCCGGGATGGCTTTCTCGCCCCCTATGACCGTCACCTGGCCGA
AGAGCTGAACGGTCTCTCCGCGGCCACGCCGGACGAACTCTTTGCCCGGTACGCCATCCACCTGACGCGA
CGGATCAACATCCTTACCGCCAGCCGGGCAGGCAGGGGGCTCGATGAACTGCGCGCCCTCCCTCAGCCGG
CGTCCCTGTCGTTCATGGCCGCTGAGACGCCGTCGGTCGCCGACGCGCACAAGCGGTTCGGAGAGCTCTA
TCTCCACTATCTTGCATGGCGATCCGACTCTCCCGACTTGGCCCGCGAGGCGGCCCAGCTCCAGGGCTGG
CTCAGGCGGTCCCTCGCGCTCAAAACCGACAGCCTTTCCTGGCTCGCCCCCTGGGTTGACCGTCATGGGG
GGCTATCACCCGTAACCCTGGCGGAGTTCTGGGGAGGAAGCGTGCCGGCCCCGGATGAGCCGACGATCAC
CCCGTCCTTCACCGGCAAGGGTAAAGACCGGATTGACGGGCTCATGCGCGAACTGGAGACCGCGGTGGGC
GACTCACGACTTCTGGCGAAGGCACGGGCAGGGTTCGTCCCCTGGTACCGGGCCCTGTGCCTGCAGGCGT
GGCAGGGATTCGCAGCCTCATTCCCCCGCGGCGCCGAGAGGCTTCGGGGCAGCGGCGAGTGGCAGCAGGC
CGCTACCCGGATGGCGACCGAGCACGGTCCGTACTTCGCGTTCATCACCCGGATGACCCAGGAGTTGCAC
ACCCTGGCGGGCACGGAGGGACTCCCTCCCTTTGCAGCACAGCTCTTCGCATTCCAGATTGCGCGAACCG
GGGGAGCCGTCTCGCACGATGCAGCAGCCAACGTCACCGCCGAAAGCCGTCGCCTCATGGCCTCCATCCG
CAGGAGGCTGGGAAACGAGGCTGCGGCCAGCACCATCGATCCGACCTTCATGGCATCGCGCAGCTGGCAG
GAATACCAGGCAGCCCTGGCGGCCATCGCTCCAGCCGCATCATCGCGGCAGCAGGCCTTCCAACTGGCAT
CCCAGACCTTCACCGATGATCCCGCCACGGGGAAAACCCCATTCCATGCAGCCTGGAATGCGGCCGCACG
GCTGAAGCGGGATATCGCCGGCGCCGGTGCCGACGACGCCTTCTGGCGCCTCGTCACCGGTCCCCTCGAT
TTTCTCTGGGGATATGTCAGGCGCGAAGCCGGTTGCCAGCTCCAGACCCTCTGGGAGGAGCAGGTCCTCG
CCCCCACCCTGGGCATGCCCCCCCAACAGGCGGGGCCAATGCTGCTGGGCGCCGATGGCCTTGCCTGGCG
CTTCGTGAAGGGCCCGGCCGCCCCCTTTGTCCGGGGCACGGCAGCGGGGTACGCCCCCCGGCAAGCACTG
GGCGGAGCGCTGCCGCTGGAGGGATCCCTCTTCGCCTTTTTGGGCAAAGGGGCACAGCTCAATGCCATGG
CATCCGGCCGGCAGTCGAACTATACCGTAGCAATCAAGGGACTTCCCACCGATGCGAACCCCGAGGCCCG
GATCAAGCCGCACGGCACGCGATTGGAGCTCCAGTGCGCCGGGCAAGCCCAGGCTCTCGCGAACCACAAC
TTTCCTGCCGGCAAGACCTTTTACTGGTCGCCCGACAGCTGCGGCGACGTGATCTTCCAGATTGAGGCGG
GCGACCAGGTACTCACAAAGCGATATGCTGGACCCCAGGCATTCCCGGACTTTCTACGCGAGTTCGCCAG
CGGGCATCGCACGTTTGCGGCCGGAGAGTTTCCCGGCGAGAAAGATGCGCTGGCTCGCATGGGGATCACC
TCAATCCGGGTAAGCTACCAGTTCACCGGCAGTCAGCAGGTGATCAGGCAGGGCGGCGCCATGGCCGGAG
CCACGGCTCCACGGATGATCGCCCGGTGCTGGTAG
 Primer design