SecReT6
Protein ID: 410418559
SecReT6 ID710
T6SS typei3
Gene symbolvrgS
Locus tagBN115_0762
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]811198..813561 [+]
Producthypothetical protein
NoteTssI
UniProt IDK0MSQ5
KEGG IDbbm:BN115_0762
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-89, Aligned region: 31..335
Phage_GPD [PF05954], Evalue: 2.10E-89, Aligned region: 649..663
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 507..529
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 530..551
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 548..567
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 564..575
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 604..624
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 619..639
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 626..648
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 660..672
Gp5_C [PF06715], Evalue: 1.20E-12, Aligned region: 676..694
Protein Sequence: 787 a.a.     [Download]
>gi|410418559|ref|YP_006899008.1| hypothetical protein BN115_0762 [Bordetella bronchiseptica MO149]
METILAMAERIVRALTPLPPQALQFRSMHGHEGLSALYEFEVDLLAATHTLELKSLLGKPVSLEIETGGA
PRYLSGQATRCALVGREGDSARQYVYRVTMRPWLWYLTQTSDSKIFQQMSVVDVLRQVLADYPFPVEYRL
AGSYRRWEYCVQYQETDFAFVSRLMEHEGIYYWFRHESGKHTLVLTDDITQHDECPGAAQLPYYGPDRAT
VPQEQYVSQWQVAEEITPDGFATVDYDFKKPAASLDAQSSNPGAYEPGGLQVYEWLGGYTEPDQGERYSR
IRLEALQAHGESVTGACNVRAFAPGYLFTLRNHPRPAENRQYLIAQAHYRIQEGGYASGAEDAVFDIDFR
VLPATVPFRVARATPVPRTHGPQTATVVGQAGEEIWTDEYGRVKVHFHWDRYGKKNENSSCWVRVSSPWA
GGGFGGIQLPRVGDEVIVDFIGGYPDRPIVIGRVYNASNMPPWDLPGNATQSGFLSRSKNGDRGTANALM
FEDSAGAERIWLHAERDMDCEVEANESHTVDGNRTTLIGGNDTLTVRGTRTTTIDGLDTETFNAGATRTV
TGEVSETTTGNETRTFNGDVTETVNGVETRTVNGDWKETITGEMTETRTGDETRTVTGAVTETITGDVTQ
TITGAVTQTQTGAHDITITGDQTSSITGAVSHTVTGAYTQTVTDPVTVNANTSMTVVTPSWTVSSASQQA
FWTANTLRGTPARLTVVGAAADFWGVRQQVYGGINSQWSTVKIDLAAFKNGANGFESGQAGAQIKAIGAQ
IKTGGAAVISRVINLFT
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|410417816|ref|NC_018829.1|:811198-813561 Bordetella bronchiseptica MO149, complete genome
ATGGAGACGATCCTCGCAATGGCCGAACGCATCGTACGCGCCCTGACCCCGCTGCCCCCGCAAGCCCTGC
AGTTTCGCAGCATGCACGGCCACGAAGGCCTGTCGGCGCTGTACGAATTCGAGGTGGACCTGCTGGCGGC
CACCCATACGCTGGAACTGAAATCGCTGCTGGGCAAGCCGGTTTCGCTGGAAATCGAAACCGGCGGCGCG
CCGCGCTACCTGTCGGGCCAGGCGACCCGCTGCGCCCTGGTGGGGCGCGAAGGCGACAGCGCGCGCCAGT
ATGTGTACCGGGTGACCATGCGGCCCTGGCTGTGGTACCTGACGCAGACCTCGGACAGCAAGATCTTCCA
GCAGATGTCGGTGGTGGACGTGCTGCGCCAGGTGCTGGCCGACTACCCGTTTCCGGTCGAGTACCGGCTG
GCCGGCAGCTACCGCCGCTGGGAATACTGCGTGCAGTACCAGGAAACCGATTTCGCCTTCGTCAGCCGCC
TGATGGAGCACGAGGGCATCTACTACTGGTTCCGCCACGAGTCGGGCAAGCACACGCTGGTGCTGACCGA
CGACATCACCCAGCACGACGAGTGTCCGGGCGCGGCGCAGCTGCCGTATTACGGCCCGGATCGCGCCACG
GTGCCTCAGGAGCAATACGTATCGCAGTGGCAGGTGGCCGAGGAGATCACGCCCGATGGCTTCGCCACCG
TGGACTACGACTTCAAGAAGCCGGCCGCCAGCCTGGACGCGCAATCGAGCAACCCGGGCGCCTACGAGCC
GGGCGGGCTGCAGGTGTACGAGTGGCTGGGCGGCTACACCGAGCCGGACCAGGGCGAGCGCTATTCGCGC
ATCCGCCTGGAAGCCCTGCAGGCGCACGGCGAAAGCGTGACCGGCGCGTGCAACGTGCGCGCCTTCGCGC
CGGGCTACCTGTTCACGCTGCGCAACCATCCGCGCCCGGCCGAGAACCGCCAATACCTGATCGCGCAGGC
GCATTACCGCATCCAGGAAGGCGGCTACGCCAGCGGCGCCGAGGATGCCGTCTTCGATATCGACTTCCGC
GTCCTGCCGGCCACGGTGCCGTTTCGCGTGGCGCGCGCCACTCCGGTGCCGCGCACGCACGGGCCGCAGA
CCGCCACGGTGGTGGGCCAGGCCGGCGAAGAGATCTGGACCGACGAGTACGGCCGCGTCAAGGTGCACTT
CCACTGGGACCGCTACGGCAAGAAGAACGAGAACAGCTCGTGCTGGGTGCGCGTGTCCAGCCCCTGGGCC
GGCGGCGGCTTCGGCGGCATCCAGCTGCCGCGCGTGGGCGACGAAGTGATCGTGGACTTCATCGGCGGCT
ATCCCGACCGGCCCATTGTCATCGGCCGCGTCTACAACGCCAGCAACATGCCGCCCTGGGACCTGCCCGG
CAACGCCACGCAAAGCGGGTTTCTCAGCCGCTCCAAGAACGGCGACCGGGGCACCGCCAACGCGCTGATG
TTCGAGGACAGCGCGGGCGCCGAACGCATCTGGCTGCACGCCGAGCGCGACATGGACTGCGAGGTCGAGG
CCAACGAGTCGCACACGGTCGACGGCAACCGCACCACCCTGATCGGCGGCAACGATACGCTGACGGTGCG
GGGCACGCGCACCACCACCATAGACGGGCTGGACACCGAAACCTTCAATGCCGGCGCCACGCGCACCGTC
ACCGGCGAGGTGTCGGAGACCACCACCGGCAACGAGACGCGCACCTTCAACGGCGACGTGACCGAAACCG
TCAACGGCGTGGAGACGCGCACGGTCAACGGCGACTGGAAGGAAACCATCACCGGCGAGATGACCGAAAC
GCGCACGGGCGACGAAACCCGCACGGTGACCGGCGCCGTCACGGAAACCATTACCGGCGACGTGACGCAG
ACCATCACCGGCGCGGTCACGCAAACGCAGACCGGCGCGCACGACATCACCATCACCGGCGACCAGACCT
CCAGCATCACCGGCGCGGTGTCGCACACGGTCACCGGCGCGTATACCCAGACGGTCACCGACCCGGTCAC
GGTCAACGCCAACACCAGCATGACCGTGGTCACGCCGTCGTGGACCGTCTCGTCGGCGTCGCAGCAGGCG
TTCTGGACCGCCAACACCTTGCGCGGCACGCCGGCGCGCCTGACGGTGGTCGGCGCCGCGGCCGACTTCT
GGGGCGTGCGCCAGCAGGTCTACGGCGGCATCAACTCGCAGTGGTCCACCGTGAAGATCGACCTGGCCGC
GTTCAAGAACGGCGCCAACGGCTTCGAGAGCGGCCAGGCCGGCGCGCAGATCAAGGCCATCGGCGCGCAG
ATCAAGACCGGCGGGGCGGCGGTGATCTCGCGCGTCATCAATCTCTTCACCTAG
 Primer design