SecReT6
Protein ID: 410418565
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0768
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]820318..821373 [+]
Producthypothetical protein
NoteTssA
UniProt IDK0MRW7
KEGG IDbbm:BN115_0768
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-23, Aligned region: 59..118
ImpA-rel_N [PF06812], Evalue: 2.00E-23, Aligned region: 228..244
Protein Sequence: 351 a.a.     [Download]
>gi|410418565|ref|YP_006899014.1| hypothetical protein BN115_0768 [Bordetella bronchiseptica MO149]
MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSEQQFGATIIPAQAPDWRAVERLALGL
LERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAAGTLEQYWDAVHPVLASGGEEDPMPRVNALASLGDPQ
GCVRGMRSACLLDDVHGRLSLRDAEALLDGGRSEADYPGGRTRLIENLRQARLRRDDAALAVGAAAGALR
RIQLQATQRLGSAWCPDYAQALRALDALLRTWSDLDETAAAPAASAPADAHRAAPAPEPQSESAPASWHD
ARIATREDAAAMLAKVSAYFETHEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFETWTAREAGNQ
S
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|410417816|ref|NC_018829.1|:820318-821373 Bordetella bronchiseptica MO149, complete genome
TTGCCGCGCATGACGACGAACATGGAATTTGCCGACCTGTTGAAGACGTTGACGCCCAGCCTGCCCTGCG
GGGAGGACCTGGAGTACGACGCTGATTTCCTGCAGTTGCAGCAGGCCGCCGTGGGCCGCAGCGAGCAGCA
GTTCGGCGCCACCATCATCCCCGCGCAGGCGCCCGACTGGCGCGCGGTGGAGCGGCTGGCGCTGGGGCTG
CTGGAGCGCACGCGCGACCTGCGCATCATCGCCTACCTGACGCGCGCCTGGACCGAGATGCGCGGCCTGC
CCGGCTATGCCGAGGGCGTGACGCTGGCCGCCGGCACGCTGGAGCAATACTGGGACGCGGTGCATCCGGT
GCTGGCCAGCGGCGGCGAGGAAGATCCGATGCCGCGCGTCAATGCGCTGGCCTCGCTGGGCGACCCGCAG
GGCTGCGTGCGCGGCATGCGCTCGGCCTGCCTGCTCGACGATGTGCATGGCCGCCTGTCGCTGCGCGATG
CCGAGGCCCTGCTCGACGGCGGCAGGAGCGAGGCCGACTATCCGGGCGGGCGCACGCGCCTGATCGAGAA
CCTGCGCCAGGCGCGCCTGCGGCGCGACGATGCGGCGCTCGCCGTGGGCGCGGCCGCCGGCGCGCTGCGC
CGCATCCAGCTGCAGGCCACCCAGCGCCTGGGCTCGGCCTGGTGTCCGGACTATGCGCAGGCGCTGCGCG
CGCTGGACGCCTTGCTGCGCACCTGGAGCGACCTGGACGAAACCGCGGCGGCGCCCGCCGCGTCCGCGCC
GGCCGATGCGCATCGCGCGGCCCCGGCGCCTGAACCCCAATCCGAATCCGCGCCCGCCAGCTGGCACGAC
GCGCGCATCGCCACGCGCGAAGACGCGGCGGCCATGCTGGCCAAGGTCAGCGCCTACTTCGAAACCCATG
AGCCCAGCCACCCGGCGCCCTATCTGATCCGCCGGGTGCAGCAGCTCATTCCCCTGGATTTCCACGACAT
CCTGCGCAACCTGGCCCCGCAGGGCCTGGCGCAGTTCGAGACGTGGACCGCGCGCGAGGCCGGCAACCAG
TCCTAG
 Primer design