SecReT6
Protein ID: 410418566
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0769
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]821416..821985 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0MDQ4
KEGG IDbbm:BN115_0769
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-57, Aligned region: 13..165
Protein Sequence: 189 a.a.     [Download]
>gi|410418566|ref|YP_006899015.1| hypothetical protein BN115_0769 [Bordetella bronchiseptica MO149]
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVGERKFLDVDID
NFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGALNEMLEARTQLANLLTYMDG
KTGAEELIGQVLQNPALLGALAAAPKPADAGPADADADAESAQPGPQAR
 
Nucleotide Sequence: 570 bp     [Download]
>gi|410417816|ref|NC_018829.1|:821416-821985 Bordetella bronchiseptica MO149, complete genome
ATGGCAACCACGCTCAAAGGCAGCGGCCAGAAATTCATCGCCAGGAATCGCGCGCCGCGCGTGCAGATCG
AGTACGACGTGGAAATCTACGGCGCCGAGCGCAAGATCCAGCTGCCGTTCGTCATGGGCGTGCTGGCCGA
CTTGGCCGGCAAGTCGAATACGCCGCAGCCCGAAGTGGGCGAGCGCAAGTTCCTCGACGTCGATATCGAC
AATTTCGACGAGCGCATGAAGTCGGTCGCCCCGCGGGCCGCGTTCCAGGTGGCCAATACGCTGACCGGCG
CCGGCCATCTGAACGTGGACATCACCTTCGAGAGCATCGACGACTTTTCCCCGGCCACCGTGGCGCGCAA
GGTGGGCGCGCTCAACGAGATGCTGGAGGCCCGCACGCAGCTGGCCAATCTGCTGACCTACATGGACGGC
AAGACCGGCGCGGAGGAGCTGATCGGCCAGGTGCTGCAGAACCCGGCCCTGCTGGGCGCGCTGGCGGCCG
CGCCCAAGCCCGCCGACGCCGGCCCGGCCGATGCCGACGCCGACGCCGAGAGCGCGCAGCCCGGCCCGCA
AGCCCGATAA
 Primer design