SecReT6
Protein ID: 410418567
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0770
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]822007..823509 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0MMJ3
KEGG IDbbm:BN115_0770
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-196, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|410418567|ref|YP_006899016.1| hypothetical protein BN115_0770 [Bordetella bronchiseptica MO149]
MTAVARRERAQAESSLAADDLSALLKKEFKPKTEQAREAVEHAVRTLAHQALENSGLGLSSDAYRTIQAI
IAEIDRKLSEQINLVMHHPDFQQLEGAWRGLHYLVTNTETDELLKIRFMCLSKNELGRTLKRYKGVGWDQ
SPIFKRVYEEEYGQFGGEPIGCLVGDYSFDHSPPDVELLGEIARISAAAHCPFIAGASPNVMQMDSWQEL
SNPRDLTKIFTNTEYAAWRSLRESEDARYVGLAMPRFLARLPYGARTNPVDEFDFEEETDGANHDRYTWA
NSAYAMAANINRSFKLYGWCTSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQRPQEYHDADASANAKLAARLPYLFACCRFAHYLKCIVRDKIGSFRERSD
MERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVTEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNEG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|410417816|ref|NC_018829.1|:822007-823509 Bordetella bronchiseptica MO149, complete genome
ATGACCGCAGTGGCCCGGCGCGAACGCGCGCAAGCCGAATCCAGCCTGGCGGCGGACGACCTGTCCGCCC
TGCTGAAGAAAGAGTTCAAGCCCAAGACCGAGCAGGCGCGCGAGGCCGTGGAGCACGCGGTGCGCACGCT
GGCGCACCAGGCCCTGGAGAACAGCGGGCTGGGCCTGTCCTCGGATGCCTACCGGACCATCCAGGCCATC
ATCGCCGAGATCGACCGCAAGCTGTCCGAGCAGATCAACCTGGTGATGCACCACCCCGACTTCCAGCAGC
TCGAAGGCGCCTGGCGCGGGCTGCACTACCTGGTCACCAACACCGAGACCGACGAGCTGCTGAAGATCCG
CTTCATGTGCCTGTCCAAGAACGAGCTGGGGCGCACGCTCAAGCGCTACAAGGGCGTGGGCTGGGACCAG
AGCCCGATCTTCAAGCGCGTCTACGAGGAAGAGTACGGCCAGTTCGGCGGCGAGCCCATCGGCTGCCTGG
TGGGCGACTACAGCTTCGACCACAGCCCGCCCGATGTCGAGTTGCTGGGCGAGATCGCCCGCATCAGCGC
CGCCGCCCATTGCCCCTTCATCGCCGGCGCCTCGCCCAACGTGATGCAGATGGATTCCTGGCAGGAACTC
TCCAACCCGCGCGACCTGACCAAGATCTTCACCAATACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAAT
CGGAGGACGCGCGCTATGTCGGCCTGGCCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGCGCGCGCAC
CAATCCGGTCGACGAGTTCGACTTCGAGGAAGAAACCGACGGCGCCAACCACGACCGGTACACCTGGGCC
AATTCGGCCTACGCGATGGCCGCCAACATCAACCGTTCGTTCAAGCTGTACGGCTGGTGCACCTCGATCC
GCGGCGTGGAATCCGGCGGCGCGGTCGAGAACCTGCCATGCCACACCTTCCCGACCGACGACGGCGGGGT
GGACATGAAGTGTCCCACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCATCGCAAGAACTCCGATTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGCGTCCGC
AGGAATACCACGACGCCGACGCCAGCGCCAACGCCAAGCTGGCCGCGCGCCTGCCCTACCTGTTCGCCTG
CTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTTCGCGAGCGCAGCGAC
ATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGACCCGGCCAACTCTTCGCAGGAAA
CCAAGGCGCGCAAGCCGCTGGCCGCCGCCGAGGTGCAGGTCACCGAGATCGAGGACAACCCGGGCTATTA
CGCCGCCAAGTTTTTCCTGCGGCCGCACTATCAGCTCGAGGGGCTGACGGTGTCGCTGCGGCTCGTGTCC
AAGCTGCCTTCGCTCAAGCAGAACGAAGGCTGA
 Primer design