SecReT6
Protein ID: 410418568
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0771
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]823585..824052 [+]
Producthypothetical protein
NoteTssD
UniProt IDK0MP42
KEGG IDbbm:BN115_0771
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-36, Aligned region: 1..129
Protein Sequence: 155 a.a.     [Download]
>gi|410418568|ref|YP_006899017.1| hypothetical protein BN115_0771 [Bordetella bronchiseptica MO149]
MKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGAGKASFNDLHVVARIDKAAPAVMKHCASG
KHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQIAADNGSEAVLVNYAFQAAKVRQQYWEQTESGGKGA
ESLVAWDIKQNKEIG
 
Nucleotide Sequence: 468 bp     [Download]
>gi|410417816|ref|NC_018829.1|:823585-824052 Bordetella bronchiseptica MO149, complete genome
ATGAAGATCGAAGGCGCCAATGGCGAATCCAAGGACGCCAACCACAAGGACTGGACCGATATCGTGTCCT
TTTCGTGGGGCGCCACCCAGCCGGCCAGCCTGGCGACCGGCGGCGGCCAGGGCGCGGGCAAGGCCAGCTT
CAACGATCTGCACGTGGTGGCCCGCATCGACAAGGCGGCGCCGGCGGTCATGAAACACTGCGCCAGCGGC
AAGCACCTGGGCAAGATCGAACTGTCGGTGTGCAAGGCGGGCGGCGCGCAGGTCGAGTACAGCAAGGTCA
CGCTGGAAGACGTGCTGGTCACCTCGGTGCAGATCGCCGCGGACAACGGTTCGGAGGCGGTGCTGGTCAA
CTATGCCTTCCAGGCCGCCAAGGTGCGTCAGCAGTACTGGGAGCAGACCGAGTCGGGCGGCAAGGGCGCC
GAGAGCCTGGTCGCGTGGGACATCAAGCAGAACAAGGAAATCGGCTGA
 Primer design