SecReT6
Protein ID: 410418569
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0772
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]824102..824911 [+]
Producthypothetical protein
NoteTagJ
UniProt IDK0MSR4
KEGG IDbbm:BN115_0772
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.50E-44, Aligned region: 147..264
TPR_20 [PF14561], Evalue: 0.0046, Aligned region: 17..58
TPR_20 [PF14561], Evalue: 0.0046, Aligned region: 122..122
Protein Sequence: 269 a.a.     [Download]
>gi|410418569|ref|YP_006899018.1| hypothetical protein BN115_0772 [Bordetella bronchiseptica MO149]
MQTPVLAMSPREGGLSGQVAAVQARIRRAPADADLRAQLFQLAAVQGDWRRAAEQLLLCARLNPLAQPMA
NLYLAAIHGEQRRVAVLAGQAEPGFLAERPCWCEPLLQALRAQAGDPERAAMLRAQAFDAAQASAGTLED
AAAGQAGYAWICDGDSRLGPVCELILDGSYAWLPFAQVAAVHLAAPQGLCDLVWARAEIALADGAVVRGL
VPARYPPSAGQDDGLRLGRATCWRPLGQDGYAGEGQKMWLTDAGEFALLDVRALRREAP
 
Nucleotide Sequence: 810 bp     [Download]
>gi|410417816|ref|NC_018829.1|:824102-824911 Bordetella bronchiseptica MO149, complete genome
ATGCAGACACCCGTGCTTGCGATGTCTCCGCGCGAAGGCGGCCTGTCCGGACAGGTCGCGGCCGTGCAGG
CGCGCATCCGGCGCGCGCCGGCCGACGCCGATTTGCGCGCGCAACTTTTCCAGCTGGCTGCCGTGCAGGG
CGATTGGCGCCGCGCCGCCGAGCAATTGCTGCTGTGCGCCCGGCTGAACCCGCTGGCCCAGCCGATGGCC
AATCTCTACCTCGCGGCCATCCATGGCGAGCAGCGGCGCGTAGCGGTGCTGGCCGGCCAGGCCGAACCCG
GCTTCCTGGCCGAGCGGCCCTGCTGGTGCGAGCCGCTGCTGCAGGCGCTGCGCGCCCAGGCGGGCGACCC
CGAGCGGGCGGCCATGCTGCGCGCCCAGGCGTTCGATGCGGCGCAGGCCAGCGCCGGCACGCTGGAAGAC
GCGGCCGCCGGCCAGGCCGGCTACGCCTGGATCTGCGACGGCGACAGCCGCCTGGGGCCGGTCTGCGAAC
TGATTCTCGACGGCAGCTATGCGTGGCTGCCGTTCGCGCAGGTGGCCGCCGTGCATCTGGCGGCCCCGCA
AGGGCTGTGCGATCTCGTCTGGGCGCGCGCCGAAATCGCCCTGGCCGACGGCGCGGTCGTGCGCGGCCTG
GTTCCGGCGCGCTATCCGCCGTCGGCCGGCCAGGATGACGGCCTGAGGCTGGGCCGGGCCACGTGCTGGC
GGCCGCTGGGCCAGGACGGCTACGCCGGCGAGGGCCAGAAGATGTGGCTGACCGACGCGGGCGAGTTCGC
GCTGCTGGACGTGCGCGCCCTGCGCCGGGAGGCGCCATGA
 Primer design