SecReT6
Protein ID: 410418570
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0773
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]824908..825426 [+]
Producthypothetical protein
NoteTssE
UniProt IDK0MRX0
KEGG IDbbm:BN115_0773
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-20, Aligned region: 39..150
Protein Sequence: 172 a.a.     [Download]
>gi|410418570|ref|YP_006899019.1| hypothetical protein BN115_0773 [Bordetella bronchiseptica MO149]
MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTHAGLRAAVLRDLRWLLNTVNLASSQDLAAYR
HVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDAIAAFEPRILESSVEVRCVSDTRTLEHHNVLSLEIRG
MLWCVPHPREFLFRTDIDLESGHMDLRDLGGA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|410417816|ref|NC_018829.1|:824908-825426 Bordetella bronchiseptica MO149, complete genome
ATGAGAATCGCCGACGAACGGGTGGCGCGCGACCGCCTGCAGCCGTCGCTGCTCGACCGCCTGGTCGATG
ACGAGCCATGGCGCCGCAGCGAGGCGCCCGAAGCGGCGCTGTTGACGCACGCCGGGCTGCGCGCCGCGGT
GCTGCGCGACCTGCGCTGGCTGCTCAACACGGTCAACCTCGCTTCGTCGCAGGATCTGGCCGCGTACCGG
CACGTGCCCGCCTCCAGCGTCAATTTCGGCGTGCGCGCCATGGCCGGACGCCGCATGTCGGAGATCGACT
GGGTCGATGTCGAGACGTCGATCCGCGACGCCATCGCGGCGTTCGAGCCGCGCATTCTGGAATCCTCGGT
CGAGGTGCGCTGCGTCAGCGACACCCGCACGCTCGAGCACCACAATGTGCTCAGCCTGGAAATACGCGGC
ATGCTGTGGTGCGTGCCGCACCCGCGCGAGTTCCTGTTCCGCACCGATATCGACCTGGAAAGCGGGCACA
TGGACCTGCGCGACCTGGGAGGGGCGTGA
 Primer design