SecReT6
Protein ID: 410418571
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0774
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]825426..827336 [+]
Producthypothetical protein
NoteTssF
UniProt IDK0MDQ9
KEGG IDbbm:BN115_0774
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.60E-212, Aligned region: 5..635
Protein Sequence: 636 a.a.     [Download]
>gi|410418571|ref|YP_006899020.1| hypothetical protein BN115_0774 [Bordetella bronchiseptica MO149]
MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPYVERLLEGFSFLAARIHLKMDAEFPR
FTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTLAGGFTLPRGTVLRGGLARGEQTPCEFMTGHALRLWP
LRVTAAEFTGAPTDLPLARLGLGGREAGVASALRLRLEVCGGVSLEELDLDQLVFYLNGPDAPMQRLLEL
VMCHTVAVLGHDSERPVSWINRLPADAVRHEGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNG
LKQGLRTPRAAAAAAGPAGTRRFDLTLLLSAAAPELEGAISAENLALHCAPIVNLFPRRADRVAVTPRHH
EYHVVVDRTRPLDFEVYGLTRVLGHMSAQRPEQEFRPFYGSFGADADDYGAYYSLRREPRLASDSARRHG
TRTSYTGSEVYLSLVDRQEAPFADTLRHLGIDALCTNRDLALLLPLGGASDFSLRVSAPVGAIKVLHGPS
RPAAAMAEHGTAWQLISHLGLHYHSLTDLDETRGAQTLRELLNLYGNLADPVARKHISGVRHVRVEPMHH
RLPVPGPIVYGRGVRIDLQVDETAFSGISPYLFGAVLEQFFARHVSINMMSALTLSTPQRGAVASWRPRM
GRRPAV
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|410417816|ref|NC_018829.1|:825426-827336 Bordetella bronchiseptica MO149, complete genome
ATGGACGCGCGCCTGCTCGACTACTACAACCGCGAGCTGGTCTACATGCGCGAGCTGGGCGCCGAGTTCG
CGCGCCAGCATCCCAAGGTGGCGGGGCGGCTGGGCATGCACGGCACCGAGGTGGCCGATCCGTACGTCGA
GCGCCTGCTCGAAGGCTTCAGCTTCCTGGCCGCGCGCATCCACCTGAAGATGGACGCCGAGTTTCCGCGC
TTCACGCAGCGGCTGCTGGAGGTGGTGCATCCGCACTATCTCGCGCCCACCCCGGCGATGGCGGTGGCGC
AGTTCTCGCCCAGCATGAACGAAGGCACGCTGGCCGGCGGCTTTACCCTGCCGCGCGGCACCGTGCTGCG
CGGCGGCCTGGCGCGTGGCGAACAGACGCCGTGCGAGTTCATGACCGGCCACGCGCTGCGGCTGTGGCCG
CTGCGCGTGACCGCTGCCGAATTCACCGGCGCGCCCACCGACCTGCCGCTGGCCCGCCTGGGCCTGGGCG
GACGCGAGGCCGGCGTGGCCAGCGCGCTGCGCCTGCGGCTGGAAGTCTGCGGCGGCGTCAGCCTGGAAGA
GCTGGACCTGGATCAACTGGTGTTCTACCTCAACGGGCCGGACGCGCCCATGCAGCGCCTGCTGGAGCTG
GTCATGTGCCACACGGTCGCCGTGCTGGGCCACGACAGCGAGCGGCCCGTCTCGTGGATCAACCGGCTGC
CGGCCGACGCGGTGCGCCACGAGGGGTTCGCCGACGACCAGGCGCTGCTGCCCACCGACACGCGGGTTTT
CCAGGGCTATCGGCTGCTGCAGGAGTACTTCGCGTTCGCGCGCCGCTACCTGTTCTTCAGCCTGAATGGC
CTGAAACAGGGCCTGCGCACGCCGCGCGCGGCGGCCGCGGCGGCCGGCCCGGCCGGCACCCGGCGTTTCG
ACCTGACGCTGCTGCTGTCGGCCGCCGCGCCCGAGCTCGAAGGCGCGATCTCGGCCGAGAACCTGGCGCT
GCACTGCGCGCCCATCGTCAACCTGTTTCCGCGCCGCGCCGACCGCGTGGCGGTCACGCCGCGCCACCAC
GAGTACCACGTGGTGGTCGACCGCACCCGGCCGCTGGACTTCGAGGTCTATGGCCTGACGCGGGTGCTCG
GCCATATGTCGGCGCAACGCCCCGAACAGGAGTTCCGTCCGTTCTACGGCTCGTTCGGCGCGGACGCCGA
CGATTACGGCGCCTACTACTCGTTGCGGCGCGAGCCGCGGCTGGCCTCGGACAGCGCGCGCCGCCACGGC
ACGCGCACCAGCTATACCGGCAGCGAAGTCTATCTGTCGCTGGTCGACCGCCAGGAGGCGCCGTTCGCCG
ACACGCTGCGCCATCTCGGCATCGACGCCCTGTGCACCAACCGCGACCTGGCGCTGCTGCTGCCGCTGGG
CGGCGCCAGCGACTTCAGCCTGCGCGTGTCCGCCCCGGTGGGCGCGATCAAGGTGCTGCATGGCCCGTCG
CGGCCGGCCGCGGCCATGGCGGAGCACGGCACGGCATGGCAATTGATCAGCCACCTGGGGCTGCACTACC
ACAGCCTGACCGACCTGGACGAGACGCGCGGCGCGCAGACGCTGCGCGAGCTGCTCAACCTGTACGGCAA
CCTGGCCGACCCGGTGGCGCGCAAGCATATCTCGGGCGTGCGCCACGTGCGGGTCGAACCCATGCACCAC
CGCCTGCCCGTGCCCGGTCCCATCGTCTACGGCCGCGGCGTGCGCATCGACCTGCAGGTCGACGAGACCG
CCTTCTCGGGCATCAGCCCCTACCTGTTCGGCGCGGTGCTGGAGCAGTTCTTCGCGCGCCACGTCTCCAT
CAACATGATGTCGGCGCTCACCCTGTCCACGCCGCAGCGCGGCGCCGTGGCGAGCTGGCGGCCCCGCATG
GGCCGCCGCCCCGCGGTCTAG
 Primer design