SecReT6
Protein ID: 410418573
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0776
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]828027..829121 [+]
Producthypothetical protein
NoteTssG
UniProt IDK0MP45
KEGG IDbbm:BN115_0776
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.60E-111, Aligned region: 28..328
Protein Sequence: 364 a.a.     [Download]
>gi|410418573|ref|YP_006899022.1| hypothetical protein BN115_0776 [Bordetella bronchiseptica MO149]
MSMDAAARTDRHAAPAALPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRHEPVRMRQEPS
LAFAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLHLTEHARERRQHHGDHALTAFADLFHHRLILL
FYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRDSVMDHAKYHMAGHLLRQTRNPEGLCQVLRA
FFGLPVGVDEFVAQWIRLEAGQRLRLGAGGGLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSVR
ARQLLHWVRLYVGVEFAWEVRPVLRRDAVRGVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQA
ARRAQAFHGEEQAA
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|410417816|ref|NC_018829.1|:828027-829121 Bordetella bronchiseptica MO149, complete genome
TTGAGCATGGACGCAGCGGCCAGGACGGATCGACACGCGGCGCCGGCGGCGTTGCCGCCTGCCTTCTGGC
AGGCCCTGGCGGCGGCGCCGCACGGGCACGACCTGTTTCACGTGCTGCGCTGGATCGACGCGCGCGCCGG
CGCGCGCGCGCCGCTGGGCCGCGGCGCCTCGCCGCGCCACGAACCGGTGCGCATGCGGCAGGAGCCTTCG
CTGGCTTTCGCGCCGGCCACCCTGGCCGCGGCGCGCGCGCCGGGCGAGGGCGCCGCGCCCGAGCTGTCCA
TCTACAGCTTCGGCCTGTTCGGTCCCAATGGGCCGCTGCCGCTGCACCTGACCGAGCACGCCCGCGAACG
CCGCCAGCATCACGGCGACCATGCCCTGACCGCGTTCGCCGACCTGTTCCACCATCGCCTGATCCTGCTG
TTCTACCGCGCCTGGGCCGATGCGCAATCCACCGCCAGCCTGGACCGCGGCCAGGAGCGCTTCAGCGGCT
ACGTGGCCAGCCTGCTGCACCTGGGCGCGCCGTCGCTGCGCCGGCGCGACAGCGTGATGGACCATGCCAA
GTACCACATGGCCGGCCATCTGCTGCGCCAGACCCGCAACCCGGAAGGCCTGTGCCAGGTGCTGCGCGCC
TTCTTCGGCCTGCCCGTGGGGGTAGACGAGTTCGTGGCGCAGTGGATAAGGTTGGAGGCCGGCCAGCGGC
TGCGGCTGGGGGCGGGCGGCGGGCTGGGCGGCGGCGCGCCCCTGGGCGTGGCCGTGCGCGACGCCCAGCA
CAAGTTCAGGATCCGCCTCGGGCCGCTGGACTGGCAGGACTACCTGGCGTTCCTGCCCGGTTCGGTCCGC
GCGCGCCAGCTGCTGCATTGGGTGCGCCTGTATGTGGGCGTGGAGTTCGCCTGGGAGGTACGGCCGGTGC
TGCGCCGCGACGCGGTGCGCGGCGTGCGCCTGGGCGCGGCGGCGCCGCTGGGGCTGGCGTCCTGGCTGGG
CCGGCGGCCGCCGCGCCTGGGCGACGCCGCCGAGCTGTTGCTGGACTACGAGGGGCGCGAGCGCCAGGCG
GCGCGGCGCGCGCAAGCGTTTCATGGAGAGGAGCAAGCGGCATGA
 Primer design