SecReT6
Protein ID: 410418577
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0780
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]832732..833529 [-]
Producthypothetical protein
NoteFha
UniProt IDK0MMK0
KEGG IDbbm:BN115_0780
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0028, Aligned region: 27..94
Protein Sequence: 265 a.a.     [Download]
>gi|410418577|ref|YP_006899026.1| hypothetical protein BN115_0780 [Bordetella bronchiseptica MO149]
MMLTLIERNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWRLHNLSGMAAV
HINDAALAPGAVRAIQAGDTLRVGAHTLEVAGPDAPDARPAALPEAAADTPADAPRRGQAGAGAAEDIFS
GLFGPGTLPVGGIADAATHPFDLDSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADAT
PSALPAHDPLAPLRADPVRDTLLPRHAAGDGPATHDHAPAGGTFLRPAAPRADQD
 
Nucleotide Sequence: 798 bp     [Download]
>gi|410417816|ref|NC_018829.1|:c833529-832732 Bordetella bronchiseptica MO149, complete genome
ATGATGCTGACGCTGATCGAACGCAACCCCGAGCCTGGCGCAAGCGCGCGCCGGGCGGATTTCCACGCGC
CCGGCGGCACGCTGGGCCGCGACGCCGAGAATTGCCTGGCCCTGCCGGCCGCGCCCGGCCAGCTATGCCG
CGTGCAGGCCGCGCTGCGCGCCGACGCGCAAGGCTGGCGCCTGCACAACCTGAGCGGCATGGCCGCGGTG
CACATCAACGACGCGGCGCTCGCGCCCGGCGCCGTGCGCGCCATCCAGGCGGGCGATACGCTGCGCGTGG
GCGCGCACACGCTGGAGGTGGCCGGGCCCGATGCGCCCGACGCACGGCCGGCAGCGCTGCCCGAGGCGGC
GGCGGACACGCCCGCCGATGCGCCCCGGCGCGGGCAAGCCGGCGCCGGCGCGGCCGAGGACATATTCAGC
GGCCTGTTCGGCCCCGGCACCCTGCCGGTGGGCGGCATCGCCGATGCCGCCACGCACCCCTTCGACCTGG
ATTCGGCGCAGGCGCGCAACGCCGCCGATCCGCTGGCGCATCTGCCGGCCGGCGACGCCGCGGTCAGCCG
CCCGGCGGGCGACCCGCTGGCGCTGTTCGACGCGCCGCATGGCGGCGCGGACGTGTTCGCCGACGCCACC
CCCTCGGCCCTGCCCGCGCACGATCCGCTGGCGCCGCTGCGCGCCGACCCGGTGCGCGACACGCTGCTGC
CGCGCCACGCGGCCGGCGACGGCCCGGCCACGCACGATCATGCGCCGGCGGGGGGTACGTTCCTGCGCCC
GGCCGCGCCGCGCGCGGACCAGGATTGA
 Primer design