SecReT6
Protein ID: 410418579
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0782
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]834217..834759 [+]
Productlipoprotein
NoteTssJ
UniProt IDK0MSS4
KEGG IDbbm:BN115_0782
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-39, Aligned region: 21..167
Protein Sequence: 180 a.a.     [Download]
>gi|410418579|ref|YP_006899028.1| lipoprotein [Bordetella bronchiseptica MO149]
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQVTLYELRSSAE
FEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQ
AQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
 
Nucleotide Sequence: 543 bp     [Download]
>gi|410417816|ref|NC_018829.1|:834217-834759 Bordetella bronchiseptica MO149, complete genome
TTGCTTGTTGCTGTGCCCACGCGGCGCGCGTTGCGCGCGGCGGCCTGGATTGCCGTCGCGGTGCTGGCCG
CCGGGTGCGCGTCCACGGCCAGCCGCAAGGCGGCGCCTTACGCGATCGAGCTGAAGGCCGATCCGCGCGT
CAATCCCGACGCCTCGGGCCGGCCCTCGCCGATCCAGGTCACGCTGTACGAGCTGCGTTCGTCCGCCGAG
TTCGAGGCGCGCGATTTCTTCACGCTGCAAGGCGACGCGCAGGCCGCGCTGGGCAAGTCGCTCATCGAAA
CCGACCAGGTCATCCTGCAGCCCGGCGAAACCCGCAAGCTGTCGTATCCGGGCAATACCGAGGCGCGCGT
GGTCGGCATCGTGGCGGCCTATCGCGACCTCGAGCGCAGCCCTTGGCGCATCGTCGTGCCCCTGCCGCAG
GCCCAGAACACCAACATCTACAAGTTCTGGCAGTTCTCGCCCAACGAGGAGACCGTGCGCGTCGCGGTGG
GCGGGCAGGGCGTGCAAATCGTCGACCGGGAGCGTTCCTGGTGGCCCTTCTGA
 Primer design