SecReT6
Protein ID: 410418580
SecReT6 ID710
T6SS typei3
Gene symbol-
Locus tagBN115_0783
StrainBordetella bronchiseptica MO149
Repliconchromosome [GenBank: NC_018829] [Browse all T6SS(s) in this replicon]
Location [Strand]834805..836139 [+]
Producthypothetical protein
NoteTssK
UniProt IDK0MRX7
KEGG IDbbm:BN115_0783
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|410418580|ref|YP_006899029.1| hypothetical protein BN115_0783 [Bordetella bronchiseptica MO149]
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGYTALEIDRDALALGKLALARAAGVLP
DGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADTLARYCVHEDEIEDSGSVGLE
PALVQLGRLRLRLVPETELGDEWVALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLL
QARAAALAQRLAQPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCAT
RLPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVH
ADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|410417816|ref|NC_018829.1|:834805-836139 Bordetella bronchiseptica MO149, complete genome
ATGGCACTGGACAACAAGGTCGTCTGGTCGGAGGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGTTCG
AACGGCATATCGAGGCGCAGTTGCGCGTGCGCGCCGCGGCGGCCTCGGGCTGCGGCTGGGGCTACACCGC
GCTGGAGATCGATCGCGACGCGCTGGCGCTGGGCAAGCTGGCGCTGGCGCGCGCCGCGGGCGTGCTGCCC
GACGGCACGCCGTTCGAGTTCGAGCGCGCCGACGAGGGGCCGCCGGCGCTGGACATCGACCCGGCCATGC
GCGATGCGCGCGTGATGCTGGCGCTGCCGCGCCGCCGCGCCGGCGCCTGCGAAGTGGTCTACGAAGACGG
CGCGGATACGCTGGCGCGCTATTGCGTGCATGAAGACGAGATCGAGGACTCCGGCTCGGTGGGCCTGGAG
CCGGCGCTGGTGCAGCTGGGCCGTTTGCGCCTGCGGCTGGTGCCCGAAACCGAGCTGGGCGACGAATGGG
TGGCGCTGGGCGCCGCGCGGGTGCTGGAGCGCCGCGCCGACCACCGCGTGGTGCTCGACGAGATGTACAT
CCCGCCCTGGCTGGCCGCCGACGCCAATCCGGCGCTGCGCGGCTACGCCGGCGAGCTGTCCGGACTGCTG
CAGGCGCGCGCAGCGGCGCTGGCGCAGCGGCTGGCGCAGCCGGGCCGCGGCGGCGTCTCCGAAGTGGCCG
ACTTCCTGCTGCTGGCGCTGGTAAACCGCTACGCCGGCGCGCTGTGGCACGCGCGCCAGGTGCCGGCCCT
GCATCCCGAACGGCTGTTTCGCGACTGGCTGATGCTGGCCTGCGACCTGGCCACCTATACCTGCGCCACG
CGCCTGCCCGAGGTGCTGCCCGATTACCGCCACGACGACCTGCAGGCCAGTTTCGGGCCGCTCATGGCCG
AGCTGCGCCGCTCGCTGTCGGTGGTGCTGGAGCAGCACGCCGTGCAGATCCCGCTGCATGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATCGCCGATGCCGAACTGCTGCGCAGCGCCGGCTTCGTGCTGGCCGTGCAC
GCCGACATGCCGGCCGAGACGGTGCGCACGCGCTTTCCGGCCCAGGTCAAGATCGGCCCGGTCGAGCGCA
TCCGCGACCTGGTGCACCTGCAATTGCCCGGCGTGGCGGTGCGCGCCCTGCCGGTGGCGCCGCGCCAGAT
TCCCTACAGCGCGGGCCACGTGTACTTCGAGCTGGACAAGAACGGCGAGTTCTGGCGGCAGCTGGAGCGC
ACCGGCGCGCTGGCCCTGCACCTGGCGGGCGAGTTTCCCGGCCTGGCGCTGGAGTTCTGGGCCGTGCGCG
ACTGA
 Primer design